KEGG   Canis lupus familiaris (dog): 608271
Entry
608271            CDS       T01007                                 

Gene name
SFMBT2
Definition
(RefSeq) scm-like with four MBT domains protein 2 isoform X1
Organism
cfa  Canis lupus familiaris (dog)
SSDB
Motif
Pfam: MBT SLED SAM_1 SAM_PNT SAM_2 SAM_Ste50p
Other DBs
NCBI-GeneID: 608271
NCBI-ProteinID: XP_005617218
Ensembl: ENSCAFG00000005121
VGNC: 46077
UniProt: F1PDM5
Position
2
AA seq 894 aa
MESSLSVSSMQDPSSSPLEKQQSSASGNGGLDSEEGSSLEEIGFNWGEYLEETGASAAPH
TSFKHVEISLQSNFQPGMKLEVANKNNPDTYWVATVITTCGQLLLLRYCGYGEDRRADFW
CDVVIADLHPVGWCTQNNKALMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGK
GPIDLITVDSLIELQDSQSPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRL
RPVGWCQENKYRMDPPSEIYPLKMASEWKCALEKSLTDAAQFPLPMEVFKDHADLRSHFF
TVGMKLETVNLSEPFHICPASVTKVFNNHFFQVTIDDLRAEPSKLSMLCHADSLGILPVQ
WCLKNGVNLTPPKGYSGQDFDWADYHKQNGTEEAPPFCFRNTSFSRGFTKNMKLEAVNPR
NPGELCVASVVSVKGRLLWLHLEGLQTPAPEFIVDVESMDIFPVGWCEANSYPLTTPHKT
VSQKKRKIAVVQPEKQLPSTVPVEKIPHDLCLLSHLDTTGTVNGKYCCPQLFINHRCFSG
PYLNKGRIAELPQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQLVEDPHWNFQEETL
KAKYRGKTYRAVAKIVRTSDQVADFCRRVCAKLECCPNLFSPVLVSENCPENCSIHTKTK
YTYYYGKRKKIIKPPIGEASAESGHPKPARRRKRRKSIFVQKKRRSSAVDFATGSGEESE
EEDADAMDEDTGSEETSSELRDDQTDTSSAEVPSVRPRRAVTLRSNSEPERRPPVERPRR
ARRVQAASRAEGADQGTATGHDPVEDAKQEDEERLVLESNPLEWTVTDVVRFIKLTDCAP
LAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggagagcagtttatcagtttctagcatgcaggacccttcctcttcacccttggagaaa
cagcagagctcagcaagcggtaatggaggtctcgattcagaagaaggttcaagcctggag
gaaattggctttaactggggagaatatctggaagaaacaggtgccagtgcagctcctcac
acctccttcaaacatgttgaaatcagccttcagagcaacttccagccggggatgaaactg
gaagtggccaataagaacaacccagacacgtactgggtggccaccgtcatcaccacctgc
gggcagctgctgctcctgcgctactgtggttatggcgaggaccgccgggccgatttctgg
tgcgacgtggtgatagcagatctgcaccctgtggggtggtgcacacagaacaacaaggcc
ttgatgcccccggatgcaatcaaagagaagtacacagactggacggagttcctcattcgt
gatttgactggctcccggacagcacctgccaaccttctagaaggtcctctgcgagggaaa
ggccctatagacctcattacagttgattccttaatagaacttcaggattctcagagccct
tttcagtactggatagttagtgtgattgaaaatgttggaggaagattacgccttcgctat
gtgggattggaggacactgaatcctatgaccagtggttgttttacttggattacagactt
cgaccagttggttggtgtcaagagaataaatacagaatggatccaccttcagaaatctat
cctttgaagatggcctctgagtggaaatgtgctctggaaaaatccctcactgatgccgca
cagtttcctcttccgatggaagtatttaaggatcatgcagatctgcgaagccatttcttc
acagttgggatgaagctagaaacagtgaatttgagcgagccctttcatatctgtcctgca
tcagtgaccaaggtttttaacaatcatttttttcaagtgactattgacgacctccgagca
gaacctagtaaactctcgatgctgtgccatgcggattctttgggaattttaccagtccaa
tggtgccttaaaaacggagtcaatctcacaccccccaaaggttactctggccaggacttc
gactgggcagattatcacaagcagaatgggacagaggaagcacctcccttctgcttcaga
aacacgtcattcagtcgggggttcaccaagaacatgaaacttgaagctgtcaaccccagg
aacccaggagagctctgcgtggcctctgttgtcagtgtgaaggggaggctgctgtggctt
cacctggaaggtctgcagactcctgctccagagtttattgttgacgtggaatctatggac
atcttcccagtgggctggtgtgaagcgaactcttaccctttgaccacaccacacaaaaca
gtctcacaaaagaagagaaagattgcagttgtgcaaccagaaaaacaattgccatccaca
gtgcctgttgagaaaatacctcatgacctctgtttgttgtctcacttggataccacaggt
actgtcaacgggaaatactgctgtcctcagctttttatcaaccacaggtgtttctcaggc
ccttacctgaacaaaggaagaatcgcagagctacctcagtcggtgggacccggcaaatgt
gtgctggttctgaaagaggttctcagcatgataatcaatgcagcttacaagcccgggagg
gtgttgcgagaactacagctggtggaagatcctcactggaattttcaggaggagacgctg
aaggcaaaatacagaggcaagacgtacagggccgtggccaagatcgtacggacatccgac
caagttgcagacttctgccggcgggtttgtgccaagctagagtgttgcccaaacttgttc
agtcctgtgctggtttcggaaaactgcccagagaactgctccatccataccaaaaccaag
tacacctattattacggaaagagaaagaagatcattaagcccccaatcggggaagccagc
gccgagagcgggcacccgaagccagccagacgaaggaagcggcgaaaatccatcttcgtg
cagaagaagcggaggtcttccgccgtggacttcgccacgggctcaggggaggagagcgag
gaagaggatgcagatgccatggacgaggacactggcagtgaggaaaccagctctgagctc
cgcgatgaccagacggacacctcttcggccgaggtgccctctgtgcggccccggagggcg
gtcaccctgaggagcaactcggagccggagcgccggccgcccgtggagaggccgcggagg
gcccgacgggtgcaggcggcctcccgtgccgagggggcggaccagggcacggccaccggc
cacgaccctgtggaggatgcaaagcaagaggacgaggagagactcgttctggagagcaac
ccgttggagtggacggtgaccgacgtggtgaggttcatcaagctgactgactgcgccccc
ttggccaagatatttcaggagcaggacattgacggccaagcgctcctgttgctgactctc
cccacggtgcaggagtgcatggagctgaagctggggcccgccatcaagctgtgccatcag
atcgagagagtgaaagtggctttctacgcccagtatgccaactga

DBGET integrated database retrieval system