KEGG   Canis lupus familiaris (dog): 608542
Entry
608542            CDS       T01007                                 

Gene name
GPC2
Definition
(RefSeq) glypican-2
  KO
K08108  glypican 2
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    608542 (GPC2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
    608542 (GPC2)
Proteoglycans [BR:cfa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   608542 (GPC2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
 Others
  608542 (GPC2)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 608542
NCBI-ProteinID: XP_013969701
Ensembl: ENSCAFG00000014535
VGNC: 41372
UniProt: J9P1X9
Position
6
AA seq 597 aa
MSALRSLLLLLLSLCPGPGPGLGSEAKVTRSCIETRQVLGARGYSLSLLPPALISGEHLR
ICPQEYTCCSSEIEQRLTWDTEATFRGLVEENGSFLVHTLASRHRKFDEIFREMLLSSEH
SLALLFHRSFGHLYSQHAPVFSGLFSRLRDYYERSGEGLDDALVDFWAQLLERLFPLLHP
QYIFSPDYLFCLTRLASSADDSLKPFGDIPRRLYLQITRALVAARAFIQGLETGRDVVSE
ALKVPMSEGCKRAVMRLTGCPLCRGVPSLPPCRGFCFNVANGCLRNQGLDPDWEAYLDAL
LLLAEKLQGSFSFELAARSIGLKISEALMYLQDNSVAVSAQVFQQCGNPERILARTRRAP
PPQEEVGRFWTPPAAAGAAAAAAPAGAGAGAGAEEERPTTTASTSMNRLVWELRERLGRA
RGFWAGLPTTVCGDPRMAADISQEAAPCWTGAGRGRYLSPVVGISPTEQLDNPEMEKEDS
GSDLQTRRRRLQLRAATTRMKVAALGRDLELEDWDEDASGSGEGQHYADDWMAGAAAVAP
PARLPRPPRRDVSGGRGGGVLVRHNQGRSRTGGTSVGFHTQPILILFLSALALLGPR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgtccgctctgcgatctcttctgcttctgctgctgtctctgtgtcccggtcctggtcct
ggacttgggagcgaggcaaaggtcacccggagttgcattgagacccggcaggtgctgggg
gcccggggatatagcttaagcctactccctcccgccctgatttcaggtgaacacctccgg
atctgcccccaggagtacacctgctgttccagtgagatagagcagaggctgacttgggac
actgaggccaccttccgaggcctggtggaagagaacggctcattcctggttcacacactg
gcctcccggcacagaaaatttgatgagatttttcgggagatgctcttgtcatctgagcac
tctctggccctgctcttccatcgctccttcggccacctgtattctcagcacgcccccgta
ttcagtggcctgttctctcggctgcgggactactatgagaggtccggtgaggggttagat
gacgctttggtggatttctgggcacagctcctggagagattgttccccctgctgcatcca
cagtacatcttctcccctgactacctgttttgcctcactcgcctcgcctcctctgctgat
gactctctgaagccttttggggacataccccgccgcctctacctgcagataacccgggcc
ctggtggccgcccgggcctttatccagggcctggagaccggaagagatgtggtcagcgaa
gcacttaaggtgccaatgtctgaaggttgcaagcgggctgtgatgcgtctgactggctgt
cccctttgtcggggcgtcccctcactgccaccctgccggggcttctgcttcaatgtggcc
aatggctgtctccgaaaccagggactggaccctgactgggaggcctatttagatgctctc
ctgttactggctgagaagctccagggttctttttcttttgagctggcagcccgatccatt
gggctgaagatctcggaagctttgatgtatctgcaggacaatagtgtggcagtgtcagcc
caggtgtttcaacaatgtgggaaccccgaacggatactggcccggacccgccgagcccca
cccccgcaggaagaggtgggccgcttctggaccccgccggctgctgcgggggcagcggcg
gcggctgcaccggcgggggcgggggcgggggcgggggcggaggaggagaggcccaccacc
acagcgagcaccagcatgaaccgcctggtgtgggagctccgcgagcggctaggccgggcg
aggggcttctgggccgggctgcccacgacggtgtgcggggacccccgcatggcggcggac
atctctcaggaggcggcaccctgctggaccggagctgggcggggccggtacttgtcgccc
gtggtcgggatctccccgaccgagcagctcgacaacccagagatggagaaggaagactcg
ggctccgacctccagacgcggaggcggcggctgcagctccgggcggccacgaccaggatg
aaggtggccgcgctgggacgcgacctggaactggaagactgggatgaggacgccagcggt
tctggagagggacagcactatgcagatgactggatggctggggcagcagctgtggcaccc
ccagcccggctgcctcgccctcctcgaagggatgttagtgggggcagaggaggaggtgtc
cttgtccgccacaaccagggcaggagcaggactggggggacatctgttggttttcacacc
caacccattctcattctcttcctctcagccctggccctgcttggaccaagataa

DBGET integrated database retrieval system