KEGG   Canis familiaris (dog): 608738Help
Entry
608738            CDS       T01007                                 

Gene name
NEDD4
Definition
(RefSeq) E3 ubiquitin-protein ligase NEDD4 isoform X1
  KO
K10591  E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04120  Ubiquitin mediated proteolysis
cfa04144  Endocytosis
cfa04530  Tight junction
cfa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    608738 (NEDD4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    608738 (NEDD4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    608738 (NEDD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    608738 (NEDD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    608738 (NEDD4)
   04121 Ubiquitin system [BR:cfa04121]
    608738 (NEDD4)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    608738 (NEDD4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     608738 (NEDD4)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    608738 (NEDD4)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   608738 (NEDD4)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    608738 (NEDD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW
Motif
Other DBs
NCBI-GeneID: 608738
NCBI-ProteinID: XP_005638494
Ensembl: ENSCAFG00000015977
UniProt: F1PYW3
Position
30
AA seq 1323 aa AA seqDB search
MAQSLRLHFAARRSNTYPLSETSGDDLDSNVHMCFKRPTRISTSNVVQMKLTPRQTALAP
LIQENVNSQERSSVPSPENVNKKSSCLQISLQPTRYSGCLQSGNVLADGDDASFTSVFKD
GIYNNAVADNELNAVNDGNLVSSSAIHSGSLSNFSTSENGSYSSNGSDYGSCTSITSGGS
YTNSIISDSSGYTFPPTDDTFFGGNLSSDSTSNRSVPNRNTTPCDIFSRSPSTVPFVQDD
LEHGLEIMKLPVTRNSKIPLKRCSSLVIFPRSPLNTPPTSPTSTDVLPSKGSYQTSHQFI
ISPSEIAHSEDGSSTKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVIANDS
LNQNVREKSSEGFSCVSVHFTQQKATTLDCETASGDCKPEMSEIKLNSHSECIKLMQRTS
ACLPSSQHLDYQININGQLERPNLQINKNHAILQRSVSLGGTYPNVSCLSSLKHNCSKGG
PSQLLIKFAPGNEDKVDNLSRDSNRDFTNELSNSLKHSCKTRDDFLGQVDVPLYPLPTEN
PRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEEDNAEQAEELEPGWVVLDQ
PDAACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTAQDNLTDAENGNMQ
LQAQRAFTTRRQISEETESVDNRESSESWEIIREDEATMYSNQAFPSPPASNNLDVQTHL
AEELNARLTICRNSATSQPVSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEK
QDERGRSYYVDHNSRTTTWTKPVVQATVETSQLQPSQSAACPQPQVPLSESAQQGTQAAE
MEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKMSLDSSNDLGPLPP
GWEERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQN
DIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLIS
KEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFI
RPFYKMMLHKPITLHDMESVDGEYYNSLRWILENDPTELDLRFVIDEELFGQTHQHELKI
GGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLM
CGLGDVDVNDWREHTKYKNGYSVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNG
FAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFD
GVD
NT seq 3972 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagcttacgattgcactttgcagccagaagaagcaatacttatcctttgtca
gaaacctccggagatgatttggatagcaatgttcacatgtgcttcaaaagaccaacacgg
atttcaacgtctaacgttgttcaaatgaagctgactcctagacagactgcactagctccg
ttgatacaggaaaacgttaactctcaggaaagatcatctgttccttcacctgaaaatgtt
aataaaaagagcagctgtctgcagatttcactacaaccaacaaggtacagtggatgtctt
cagtctggcaatgtcttagctgatggtgatgatgcttcatttacatctgtctttaaggat
ggcatttacaacaatgctgtggctgataatgagctgaatgctgtgaatgatggtaacctt
gtaagcagttcggccattcacagtgggagcctcagtaacttttccaccagtgagaatggg
tcttacagcagcaatggtagtgattatggatcatgcacaagtatcacaagtggtggttcc
tacacaaacagtatcatcagtgacagcagtggttatacttttccaccaactgatgatact
ttttttggtggaaatttatcttctgacagcacctccaatagaagtgtgccaaacaggaat
actactccatgtgacattttttcaagaagtccaagtaccgttccttttgtccaggatgac
ttggagcatggactagaaattatgaaattgccagtgaccaggaactcgaaaattccacta
aaacgttgttcatccttagtcatttttcctaggagtcctttaaataccccaccgacttct
ccaacaagtacagacgttcttccaagcaaaggatcctatcaaacctcacaccaatttatt
atttctcctagtgaaattgcccacagtgaagatggtagtagcactaagggatttctttca
acagctgtcaatggacttcggttatctaaaacaatctgtactcccggagaagtgagagac
atacgaccacttcacaggaagggttcattacaaaagaaaattgttattgcgaatgatagt
ctgaatcagaatgtccgtgaaaagtcgtctgaagggttttcttgtgtttcagtgcatttc
acccaacaaaaagcaactacattagattgtgaaacagcaagtggtgattgcaaaccagag
atgtcagaaatcaagcttaattctcattcagagtgcattaagcttatgcagaggacatct
gcatgtttaccatcctctcaacacctagattaccaaataaatatcaatggacagttggaa
agaccaaatttacagataaacaaaaaccatgctattttacagagaagtgtttcattggga
ggaacttacccaaatgtttcctgtttatccagcctcaagcacaattgttctaagggggga
ccatcacaattactcataaaatttgcacctggaaatgaagataaagttgataacttatca
agagacagtaacagagatttcacaaatgaactatctaattctttaaagcattcttgtaag
accagagatgatttcctaggtcaagtggatgttcctctttatccattaccgacagaaaat
ccaagaatggagagaccatatacgtttaaggattttgttcttcacccaagaagtcacaaa
tcaagagttaaaggttatttgagattaaaaatgacttatttacctaaaaccagtggctca
gaagaagataacgcagaacaggccgaggaactagagcctggctgggttgttttggaccaa
ccggatgctgcctgccatttgcagcagcagcaagaaccttctcctctacctccaggatgg
gaagagaggcaggatattcttggaaggacctactatgtaaaccatgaatctagaagaaca
cagtggaaaagaccaaccgctcaggacaacctaactgatgctgagaatggtaacatgcaa
ctgcaagcacagcgtgcatttactaccagacggcagatatctgaggaaacagaaagtgtg
gataatcgagagtcttccgagagctgggaaattataagagaagatgaagccaccatgtat
agcaatcaggccttcccatcacctccagcatcaaataacttggatgttcagactcatctt
gcagaagaattgaatgccagactcacaatttgtagaaactcagccaccagccagccagta
tccagctcaaatcattccagcagaagaggcagcttacaagcctatacttttgaggaacag
cctacacttcctgtgcttttgcctacttcatctggattaccaccaggttgggaggaaaaa
caagatgaaagaggaagatcatattatgtagatcacaattccagaactactacctggaca
aagcccgttgtacaggccacggtggagaccagtcagctgcagccaagccagagtgcggca
tgtcctcaaccacaggtccccttgagtgagtcagcgcagcaggggacccaggcggctgaa
atggagcaaggattcctccctaaaggctgggaagtccggcatgcgccaaatgggaggcct
ttctttattgaccacaacaccaaaaccactacctgggaagatccaagactgaaaattcca
gctcatctgagaggaaagatgtcactggattcttccaatgatctggggcctttacctcca
ggatgggaagaaagaactcatacagatggaagaatcttctacataaatcacaatataaaa
agaacacaatgggaagatcctcggttgcaaaatgtagcaataactggaccagcagtgccc
tactccagggattacaaaagaaagtatgagttcttccgacgaaagttgaagaagcagaac
gacattccaaacaaatttgaaatgaaacttcgccgtgcaactgttcttgaggactcttac
aggaggattatgggtgtcaagagagcggatttcctcaaggctcgactgtggattgagttc
gatggtgaaaagggattagattacggaggagtcgctagagaatggtttttcctgatctca
aaggaaatgtttaacccttattatgggttgtttgaatattctgctacggataattacacc
ctacagataaatccaaactctggattgtgtaacgaggatcacctctcttacttcaagttt
attggccgagtagctggaatggcagtttatcatggcaaactgttggatggtttcttcatc
cgcccattttacaagatgatgctacacaaaccaataacacttcatgatatggaatcggtg
gatggtgaatattacaattcactaagatggattcttgaaaatgatccaacagaattggac
ctcaggtttgtcatagatgaagaactttttggacagacacatcaacatgaattgaaaatt
ggtggatcagaaatagttgtcaccaataagaacaaaaaggaatatatttatcttgtaata
cagtggcgatttgtaaaccgaatccagaagcaaatggctgcttttaaagagggatttttt
gaactaataccacaggatctcatcaaaattttcgatgaaaatgaactagagcttcttatg
tgtggattgggagatgtcgatgtgaatgactggagagaacacacaaaatataagaatggc
tacagtgtgaatcatcaagtcatacagtggttctggaaggctgttctaatgatggattca
gaaaaaagaataagattacttcagtttgtcactggtacatctcgagtgcctatgaatgga
tttgctgaactctatggctcaaatggaccacagtcatttacagttgaacagtggggtacc
ccggaaaagctgccaagagcccatacatgctttaatcgcttggacttgccaccctatgaa
tcatttgaagaattatgggataaactgcagatggcaattgagaacactcaaggctttgat
ggcgttgattag

DBGET integrated database retrieval system