KEGG   Canis lupus familiaris (dog): 609233
Entry
609233            CDS       T01007                                 

Symbol
DYNLL1
Name
(RefSeq) dynein light chain 1, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04962  Vasopressin-regulated water reabsorption
cfa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    609233 (DYNLL1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    609233 (DYNLL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    609233 (DYNLL1)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     609233 (DYNLL1)
SSDB
Motif
Pfam: Dynein_light
Other DBs
NCBI-GeneID: 609233
NCBI-ProteinID: XP_851264
Ensembl: ENSCAFG00000046342
VGNC: 40150
UniProt: A0A5F4CQ75
Position
26
AA seq 89 aa
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtgcgaccgaaaggcggtgatcaaaaacgccgatatgtcggaggagatgcaacaggac
tcggtggagtgtgcgactcaggcgttggagaaatataacatagagaaggacattgcggcc
catattaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtggggagg
aacttcggtagttatgtgacacatgaaaccaaacacttcatctacttctacctgggccaa
gtggccattcttctgttcaaatctggttaa

DBGET integrated database retrieval system