KEGG   Canis familiaris (dog): 609445
Entry
609445            CDS       T01007                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC11 isoform X1
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    609445
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     609445
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    609445
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 609445
NCBI-ProteinID: XP_005639748
Ensembl: ENSCAFG00000024813
UniProt: J9P930
Position
34
AA seq 427 aa
MDLCSRSWRWVVPEAGGKQASPPHLSRVNGWSRPLHSFQVVAWATFLILAVANFGIFIPF
LPHNWKYVAYGVTGGLFFLHFLVHLITVSIDPAEANVRLKNYSEPMPTFDQSKHTHVIQN
QYCHLCELTLSEKAKHCSACNKCISGFDHHCKWLNNCVGSRNYWYFFCSVASALAGVVCL
TAILLYIFIQFFINPAELRTHPYYKKISNKNTWLLFLPLFPVKTKIPVVLGIGVLVLLLD
VISLLLLGHLLIFHLYLMAKKLSTFDYMTQRRHQKTPARALSEKKELSFPIGSPQKADDP
SSSAHGEKHKEPQPPPKYPSLCSTTTMYSENSLLLKMRDMEENLSSSAERVKPKELLLPD
LHSRQACSTTTVSENSWLKEADGNPTVLVLGRPRQKVLLSLSGSTNLSSASSTSPENSLL
PKVSKEE
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggatttgtgcagcaggagctggagatgggtcgtcccagaagccgggggcaagcaggcc
tcacccccccacctgtcccgagtgaatggctggtcgaggcccctgcactccttccaggtg
gtggcctgggccacattcctcatcttggctgttgccaactttggcatcttcattcccttc
ctgccacataactggaagtacgttgcctacggtgtgactggtgggctcttctttctccac
ttcctggtccacttgattacagtttccatcgacccagctgaagctaacgtccgtctcaag
aactactctgagcctatgccaacctttgaccagtccaaacacacacatgtgatccagaac
cagtactgccacctgtgtgagctcaccctgagcgagaaagccaaacactgtagcgcctgc
aacaagtgcatctctggctttgaccaccactgcaaatggctgaacaactgtgtgggcagc
aggaattactggtacttcttctgctccgtggcctccgccttggccggtgtggtctgcctg
acagccatcctgctctatatcttcatccagttcttcatcaacccagcagagctccgcacg
cacccctactacaaaaagatctccaacaagaacacctggctgctgttcctcccacttttc
cctgtaaagacgaagatcccggtggtcctcggcattggggtgctagtgctgctgttagat
gtcatcagcctcctactgcttgggcacctgcttatcttccatctctacctaatggccaag
aagttgagcacatttgactacatgacacagcgccgccaccaaaagactccagcaagagct
ttatcagaaaagaaagagctgtccttcccaataggatccccacagaaagcagacgatccg
agttcttctgcacatggagagaagcacaaggagccgcagccaccaccgaagtatccaagt
ctgtgctccaccactaccatgtactcagagaactccttgctgctgaagatgcgggacatg
gaggagaacctgagttcatccgcagagagagtgaagcctaaggagctcctgctgccagac
ctgcactcacgtcaggcctgctccaccaccacagtctcagagaactcgtggctaaaggaa
gcggatggtaacccgactgtgttggtactcggcagacctaggcagaaggtgctcctgtcg
ctgtcggggtcgacaaacctgagctctgcctccagcaccagcccggagaactccttgttg
cccaaggtttcaaaggaagaataa

DBGET integrated database retrieval system