KEGG   Canis familiaris (dog): 609616Help
Entry
609616            CDS       T01007                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X2
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04022  cGMP-PKG signaling pathway
cfa04270  Vascular smooth muscle contraction
cfa04540  Gap junction
cfa04611  Platelet activation
cfa04713  Circadian entrainment
cfa04714  Thermogenesis
cfa04730  Long-term depression
cfa04740  Olfactory transduction
cfa04923  Regulation of lipolysis in adipocytes
cfa04970  Salivary secretion
Module
cfa_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    609616 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    609616 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    609616 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    609616 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    609616 (PRKG1)
  Digestive system
   04970 Salivary secretion
    609616 (PRKG1)
  Nervous system
   04730 Long-term depression
    609616 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    609616 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    609616 (PRKG1)
   04714 Thermogenesis
    609616 (PRKG1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     609616 (PRKG1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: AGC group
  PKG family
   609616 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 609616
NCBI-ProteinID: XP_022266224
Ensembl: ENSCAFG00000031979
VGNC: 49844
Position
26
AA seq 600 aa AA seqDB search
MCHRVIFPGEDQPIEHLASKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCII
KEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWA
IDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQ
GARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAV
TCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGF
GRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDS
KYLYMLMEVCLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLI
LDHRGYTKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYEL
LTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVK
DIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtgccatcgagtcatcttcccaggggaggatcagccaatagagcacttagcgtccaag
gatctcataaaggaagcaatccttgacaatgacttcatgaagaacctggagctgtcgcag
atccaggagattgtggattgtatgtacccggtggagtacggcaaagacagttgcatcatc
aaagaaggagatgtggggtcactggtgtacgtcatggaagatggtaaggttgaagtcacg
aaagaaggtgtgaagctgtgtaccatggggccaggaaaagtgttcggggagttggcgatt
ctttacaactgtacccggacggcgaccgtcaagactcttgtaaatgtgaaactctgggcc
atcgatcgacaatgtttccaaaccatcatgatgaggacgggactcatcaagcataccgag
tatatggaatttttaaaaagtgtccccacgttccagagccttcctgaagagatcctgagt
aagcttgctgatgtccttgaagagacccactatgagaatggggaatatatcatcaggcaa
ggtgcaagaggcgacaccttctttatcatcagcaaaggaacggtgaatgtcactcgggaa
gactcacccagtgaagacccggtctttcttagaactttagggaaaggagactggtttgga
gagaaagccttgcagggggaggatgtgaggacagcaaacgtaattgccgcagaagctgtg
acctgccttgtcatcgacagagactctttcaagcatttgattggaggactggatgatgtt
tccaataaagcatatgaagatgcagaagctaaagcaaaatacgaagccgaagctgctttc
ttcgccaacctgaagctgtctgacttcaacatcatcgacaccctcggcgtcggaggcttc
ggacgcgtggagctggtccagttgaaaagtgaagaatccaaaacctttgctatgaagatt
ctcaagaaacgccacatcgtagacacaagacagcaggagcacatccgctccgagaagcag
atcatgcagggggcgcattccgacttcatagtgagattgtacaggacgtttaaggacagc
aaatatttgtacatgttgatggaagtgtgcctaggtggagagctctggaccattctcagg
gatcgaggttcatttgaagattctacgaccagattctacacagcatgcgtggtggaggcg
ttcgcctatctgcattccaaaggaatcatttacagggacctcaagccagagaatctcatc
ctggatcacagaggctacaccaagctggttgattttggctttgcaaagaaaataggattt
ggaaagaaaacatggactttttgtgggactccagaatacgtagctccagagatcatcctg
aacaaaggccatgacatttcagccgactactggtcactgggaatcctaatgtatgaactt
ctgactggcagcccacctttctcaggcccagatcctatgaaaacctataacatcatactg
agggggattgacatgatagaatttccaaagaagattgccaaaaatgctgctaacttaatt
aaaaaactctgcagggataacccatcagaaagattagggaatttgaaaaacggcgtgaaa
gacattcagaagcacaaatggtttgagggctttaattgggaaggcttaagaaaaggcacc
ttgacacctcctataataccaagtgttgcatcacccacagacacaagcaatttcgacagt
ttccctgaggacaatgatgaaccgccacctgatgacaactcaggatgggacatagacttc
taa

DBGET integrated database retrieval system