KEGG   Canis familiaris (dog): 609725Help
Entry
609725            CDS       T01007                                 

Gene name
RAPSN
Definition
(RefSeq) 43 kDa receptor-associated protein of the synapse
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: Rapsyn_N TPR_12 TPR_1 TPR_2 TPR_8 TPR_7 TPR_MalT zf-RING_2 zf-RING_11 TPR_19 SNAP zf-RING_5 TPR_10 Prok-RING_4 zf-RING_UBOX zf-RING_9 RPN7 zf-RING_4 zf-C3HC4 zf-rbx1 Cys_rich_CPXG
Motif
Other DBs
NCBI-GeneID: 609725
NCBI-ProteinID: XP_850095
Ensembl: ENSCAFG00000008690
VGNC: 45350
UniProt: F6V3D2
Position
18
AA seq 412 aa AA seqDB search
MGQDQTKQQIEKGLQLYQSNQTEKALHVWMKVLEKSADLVGRFRVLGCLVTAHSEMGRYK
EMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCVGLPGTRAGAQ
LGGQVSLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYE
KALFFPCKAAELVSDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHG
DRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQVLLGVAKCWIARK
ALDKALDVIEKAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETE
LYCGLCGESIGERNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggaccagacgaagcagcagatcgagaaggggctccagctgtaccagtccaac
cagaccgagaaggcgctgcacgtgtggatgaaggtgctggagaagagcgccgacctcgtg
gggcgcttccgcgtgctgggctgcctggtgacggcgcactcggagatgggccgctacaag
gagatgctgaagttcgctgtggtgcagatcgacacggctcgggagctggaggatgccgac
ttccttctggagagctacctgaacctggcacgcagcaacgagaagctgtgtgagttccac
aagaccatctcctactgcaagacttgcgtcggcctgcccggcaccagggcgggcgcccag
ctcggaggccaggtcagcctgagcatgggcaatgccttcctgggcctcagcctcttccag
aaggcgctggagagcttcgagaaggccctgcgctatgcccacaacaatgacgacaccatg
ctcgagtgccgcgtctgctgcagcctgggcagcttctatgcccaggtcaaggactacgag
aaagccctgttcttcccctgcaaggccgcagagctcgttagcgactacggcaaaggctgg
agcctcaagtaccgggccatgagccagtaccacatggctgtggcgtaccgcctgctgggc
cacctgggcagtgccatggagtgttgtgaggaatctatgaagattgcactgcagcacggg
gaccggccactccaggcactctgcctgctgtgctttgctgacatccaccggagccgtggg
gacctggagacagccttccccaggtacgactctgccatgagcatcatgactgagattgga
aaccgcctggggcaggtgcaggtgctgctgggagtggccaaatgctggatagccaggaaa
gcactggacaaggctctggatgtcatcgagaaagcccaggacctggcggaggaagtgggg
aacaagctaagccagctcaagctgcactgcctgagtgagagcatctaccgcagcaagggg
ctgcagcgggagctgcgtgcccatgtcgtgcgcttccatgagtgtgtggaggagactgag
ctctactgcgggctgtgtggcgagtccataggtgagaggaacagccggctgcaggccctg
ccctgctcgcacatcttccacctcaggtgcctgcagaacaacgggacgcggagctgcccc
aactgccgccgctcatccatgaagcctggctttgtgtga

DBGET integrated database retrieval system