KEGG   Canis lupus familiaris (dog): 609731
Entry
609731            CDS       T01007                                 

Gene name
POLR3G
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC7 isoform X1
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03020  RNA polymerase
cfa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    609731 (POLR3G)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    609731 (POLR3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    609731 (POLR3G)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     609731 (POLR3G)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 BUD22 SAPS
Other DBs
NCBI-GeneID: 609731
NCBI-ProteinID: XP_005618179
Ensembl: ENSCAFG00000008281
VGNC: 44805
UniProt: F6XAL6
Position
3
AA seq 223 aa
MAGNKGRGRAAYTFNIEAVGFGRGEKLPDVVLKPPPLFPDTDYKPVPLKAGEGEDYMLAL
KQELRETMKRMPYYIETPEEKQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRKKCKKAG
PKSEKAKDTGKGTSLTNTADVLKKIEELEKRGDGEKSDEENEEKEGSKEKSKEGDEEEDD
DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctgggaataaaggacgtggacgtgcagcttatacctttaatattgaggcagttgga
tttggcagaggtgaaaagttacctgatgtagtattgaaaccacccccactatttcccgat
acagattataaaccagtgccactgaaagcaggagagggtgaagattacatgctggccttg
aaacaggagttgagagaaactatgaaaagaatgccttattatatagaaacacccgaagaa
aaacaagatattgaaagatatagtaaaagatatatgaaggtgtacaaagaggagtggata
ccagattggagaagactcccaagagaaatgatgccaaggaagaagtgcaaaaaagcaggc
cccaaatccgaaaaggcgaaagatacaggcaaaggcacctcgctcactaatactgcagat
gtgttgaaaaaaatcgaggaattggaaaagagaggtgatggtgaaaaatcagatgaggaa
aatgaagagaaagaaggaagcaaagagaaaagtaaagaaggtgatgaggaggaggacgat
gatgctgcagaacaagaggaatatgatgaagaagagcaagaagaggaaaatgactacatt
aattcatactttgaagatggagatgattttggtgcagacagtgacgacaacatggatgaa
gcaacctattaa

DBGET integrated database retrieval system