KEGG   Canis familiaris (dog): 609767
Entry
609767            CDS       T01007                                 

Gene name
CHEK1
Definition
(RefSeq) serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04110  Cell cycle
cfa04115  p53 signaling pathway
cfa04218  Cellular senescence
cfa05166  Human T-cell leukemia virus 1 infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    609767 (CHEK1)
   04115 p53 signaling pathway
    609767 (CHEK1)
   04218 Cellular senescence
    609767 (CHEK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    609767 (CHEK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    609767 (CHEK1)
   05170 Human immunodeficiency virus 1 infection
    609767 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    609767 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfa03400]
    609767 (CHEK1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     609767 (CHEK1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   609767 (CHEK1)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    609767 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 609767
NCBI-ProteinID: XP_013968787
Ensembl: ENSCAFG00000010551
VGNC: 53319
Position
5
AA seq 492 aa
MWHGRRESNEGKTVGHVIFNLLKFSKKQNSGVFLFFFRVQLAVNRRTEEAVAVKIVDMKR
AIDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPE
QDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDDRDNLKISDFGLATVFRHNNRERLL
NKMCGTLPYVAPELLKRKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEK
KTYLNPWKKIDSAPLALLHKILVENPSVRITIPDIKKDRWYNKPLKKGAKRPRVTSGGVS
ESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSVWDTSPSYIDKLVQGISF
SQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQW
KKSCMNQVTVSTTDRRNNKLIFKVNLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSD
VVSSQKVWLPAT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtggcacgggagacgagaaagtaatgaaggtaaaactgttggacacgtcatatttaat
cttttaaagttttcaaagaaacagaattcaggtgtgttccttttcttttttagggttcaa
cttgctgtgaatagaagaactgaagaagcagttgcagtcaagattgtagacatgaagcgt
gccatagactgtccagaaaatattaagaaagagatctgtatcaataaaatgttaaatcat
gagaatgtagtgaaattctatggtcacaggagagaaggcaatatccagtatctgtttctg
gagtactgtagtggaggagaactttttgacagaatagagccagacataggcatgcctgaa
caagatgctcagaggttctttcaccaactcatggcaggagtggtttatctgcatggtatt
gggataactcatagggatattaagccagaaaatcttcttttggatgaccgggataacctc
aaaatctctgactttggcttggcaacagtgtttcggcataataatcgtgaacgtttattg
aacaagatgtgtggtactttaccttatgttgctccagaacttctaaagagaaaagaattt
catgcagaaccagttgatgtttggtcctgtggaatagtacttacagcaatgttggctgga
gaattaccatgggaccagcccagtgacagttgtcaagaatattctgattggaaagaaaaa
aaaacataccttaacccttggaaaaaaattgattcagctcctcttgctttgctgcataaa
atcctagttgagaatccatcagtaaggattaccatcccagacatcaaaaaagatagatgg
tacaacaaaccactcaagaaaggagcaaagaggccccgagtcacttcaggtggtgtatca
gagtctcctagtggattttctaagcacattcaatccaatttggacttctctccagtgaac
agtgcctctagtgaagaaaatgtgaagtactccagttcccagccagaaccacggacaggt
ctttccgtatgggacactagcccttcatatattgataagctggtacaagggatcagtttt
tcccaacccacatgtcctgatcatatgctcctgaatagtcagttacttggcaccccggga
tcctcacagaacccttggcagcgcttggtgaaaaggatgacacgattttttaccaaattg
gatgcagacaaatcttatcaatgcctgaaagagacttgtgagaaattgggctatcagtgg
aaaaagagttgtatgaatcaggttactgtatcaacaactgataggagaaacaataagctg
attttcaaagtgaatttggtagaaatggatgagaagatcttggttgactttcggctctct
aagggagatggattagaattcaagagacacttcctgaagattaaagggaagctgagtgat
gttgtgagcagccagaaggtttggcttcctgccacatga

DBGET integrated database retrieval system