KEGG   Canis lupus familiaris (dog): 609935
Entry
609935            CDS       T01007                                 

Gene name
RNF152
Definition
(RefSeq) E3 ubiquitin-protein ligase RNF152
  KO
K15705  E3 ubiquitin-protein ligase RNF152 [EC:2.3.2.27]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    609935 (RNF152)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    609935 (RNF152)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     609935 (RNF152)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    609935 (RNF152)
SSDB
Motif
Pfam: zf-RING_5 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-RING_11 zf-C3HC4_2 zf-C3HC4_4 VMA21 Prok-RING_4 zf-RING_10 DUF3357
Other DBs
NCBI-GeneID: 609935
NCBI-ProteinID: XP_013963542
Ensembl: ENSCAFG00000032187
VGNC: 45641
UniProt: J9NXR2
Position
1
AA seq 203 aa
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL
PPGFSVSQLPDDPEVLAVIAIPHASEHTPVFIKLPSNGCYMLPLPIAKERALLPGDLGCR
LLPGSQQKPVTVVTIPGEQQPLQGGPPQEAAEEEPDRRGAAKSSTWSGVCTVILVACVLV
FLLGIVLHNMSCISKRFTVISCG
NT seq 612 nt   +upstreamnt  +downstreamnt
atggagacgctctcccaagattctttgctggaatgtcagatctgtttcaattactacagc
ccccggcgaaggcccaagctgctggactgcaaacacacctgctgctcggtgtgcctccag
cagatgaggacgagccagaaggacgtgagatgcccgtggtgccggggcatcaccaagctg
cccccgggcttctccgtgtcgcagctccccgacgaccccgaggtcctggcggtcatcgcc
atcccgcacgcgtccgagcacaccccggtcttcatcaaacttcccagcaatgggtgctac
atgctgcccctgcccatcgccaaagagcgagcgctgctgcccggagacctgggctgccgc
ctgctgcccgggagccagcagaagcccgtcacggtggtgacgatccccggggaacagcag
cccctgcagggggggccgccccaggaggcggcggaggaggagccagacaggcggggcgcg
gcgaaaagctccacctggtccggggtgtgcactgtgatccttgtggcctgcgtcctggtc
ttcctcctgggcatcgtgctgcacaacatgtcttgcatttctaagcgcttcactgtgata
tcctgtggctga

DBGET integrated database retrieval system