KEGG   Canis familiaris (dog): 610191
Entry
610191            CDS       T01007                                 

Gene name
PICK1
Definition
(RefSeq) PRKCA-binding protein
  KO
K24062   
Organism
cfa  Canis familiaris (dog)
SSDB
Motif
Pfam: Arfaptin PDZ PDZ_6 BAR PDZ_2 BAR_3 GRASP55_65
Other DBs
NCBI-GeneID: 610191
NCBI-ProteinID: XP_005625950
Ensembl: ENSCAFG00000001431
VGNC: 44525
UniProt: E2RPE0
Position
10
AA seq 417 aa
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLSQDEFTDGEDEEDEDDEDTATGEPSRDARGAAGPLDKGGSWCDS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtttgcagacttggattatgacatcgaggaggataaacttggaatccctactgtgcct
gggaaggtgaccctacagaaggatgctcagaacctgatcgggatcagcatcggaggaggg
gcccagtactgcccctgcctctatattgtccaggtgtttgacaacaccccagcagccctg
gacggcactgtggcggctggcgacgagatcaccggtgtcaatggcaggtcaatcaaaggc
aaaactaaggtggaggtggcaaagatgattcaggaggtgaagggtgaggtgacgatccac
tacaacaagctgcaggcggaccccaagcagggcatgtcccttgacattgtgttgaagaaa
gtaaagcatcggctggtagagaacatgagctccgggactgcagatgccctgggcctgagc
cgggccatcctgtgcaatgacgggcttgtcaagaggctggaggagctggagcggacagcc
gagctgtataaaggaatgacggaacacaccaagaacctcctccgggccttttacgaactg
tcacagacacaccgggcctttggggacgtgttctctgtgattggggtgcgggagccccag
ccagccgcgagtgaggcttttgtgaagtttgctgacgcccaccgcagcatcgagaagttc
ggcatccggctgctgaaaaccatcaagccgatgctgacagacctgaatacgtacctcaac
aaagccatcccagacactcgcctcaccatcaagaagtacctggatgtgaagtttgagtac
ctgtcctactgcctgaaggtgaaggaaatggatgacgaggagtacagctgcatcgccctg
ggggagcccctgtaccgcgtgagcactggcaactatgagtatcgcctgatcctgcgctgt
cgccaggaggcccgtgcccgcttctcccagatgcgcaaggatgtgctggagaagatggag
ttgctggaccagaagcatgtccaggacatcgtgttccagctgcagcgcttcgtgtccacc
atgtccaagtactacaacgactgctacgcggtgctgcgtgatgccgatgtcttccccatc
gaggtggacctggcccacaccacgctggcctacggcctcagccaggatgagttcaccgac
ggggaggacgaagaggatgaagatgacgaggacacagctactggggagccgtccagagat
gcacgaggggctgccgggcccctggacaagggtgggagctggtgtgactcctga

DBGET integrated database retrieval system