KEGG   Canis familiaris (dog): 610238Help
Entry
610238            CDS       T01007                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2
  KO
K03259  translation initiation factor 4E
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa03013  RNA transport
cfa04066  HIF-1 signaling pathway
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04211  Longevity regulating pathway
cfa04910  Insulin signaling pathway
Module
cfa_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    610238 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    610238 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    610238 (EIF4E2)
   04150 mTOR signaling pathway
    610238 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    610238 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    610238 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    610238 (EIF4E2)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     610238 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     610238 (EIF4E2)
Translation factors [BR:cfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    610238 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 610238
NCBI-ProteinID: NP_001238872
Ensembl: ENSCAFG00000011328
Position
25
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaaaagtcagggc
agcagtaagaggaaggctgttgtccctgggccagcagagcatcccctgcagtacaactat
actttctggtactccagaagaacccctggccgtcccaccagctcacagagctatgaacag
aatatcaaacagatcggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcctggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aagcccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcgactgcgg
aagggcttggcatcccgttgctgggagaatctcatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgcatccgggataccctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system