KEGG   Canis lupus familiaris (dog): 610283
Entry
610283            CDS       T01007                                 
Symbol
CTTN
Name
(RefSeq) src substrate cortactin isoform X1
  KO
K06106  cortactin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04530  Tight junction
cfa05100  Bacterial invasion of epithelial cells
cfa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    610283 (CTTN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    610283 (CTTN)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    610283 (CTTN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    610283 (CTTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    610283 (CTTN)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    610283 (CTTN)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    610283 (CTTN)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     610283 (CTTN)
SSDB
Motif
Pfam: HS1_rep SH3_9 SH3_1 SH3_2 TAF4 DUF1351 MCU
Other DBs
NCBI-GeneID: 610283
NCBI-ProteinID: XP_038310309
Ensembl: ENSCAFG00000010478
VGNC: 39718
Position
18:complement(46539259..46571258)
AA seq 581 aa
MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVTGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQVDRVDQSAVGFEYQGKTEKHASQRDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYKAGFGGRFGVQSERQDSCAVGFDYKERLAKHESQQ
DYSKGFGGKYGVQKDRMDKNASTFEDVAQVAPAYQKTVPVEAVNSRTSNIRANFENLAKE
KEQEDRRKAEAEKAQRMAKERQEQEEARRQLHEQAQAQAQKPTPPASPTPQPAQEKPPPS
PVYEQVMPPYPHIHVADPLELRSSRVLVTWHGPQEMSPDPSLPQDAASFKAEPEPVYSME
AADYQDASSQQGLAYAPDAVYEATETSGHYQAEENTYDEYENDLGITAVALYDYQAAGDD
EISFDPDDIITNIEMIDDGWWRGLCKGRYGLFPANYVELRP
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtggaaggcttcggcaggccatgctgtgtccatcacccaggacgacggcggcgccgat
gactgggagactgaccctgactttgtgaacgacgtgagcgagaaggagcagaggtgggga
gcgaaaaccgtgacggggtctgggcaccaggagcacatcaacatacacaagcttagagag
aatgtttttcaagaacaccagaccctcaaggaaaaggagcttgaaacgggaccaaaggcc
tctcatggttatggcgggaagtttggcgtggagcaggacaggatggacaagtcagctgtc
ggccatgagtatcagtcgaagctctccaagcactgctcccaggtggactccgtccggggc
tttggaggcaagtttggtgtccaggtggacagagttgatcagtctgctgtaggctttgaa
taccaggggaagaccgagaagcacgcctcacagagagactactcaagtgggttcggtggc
aagtatggcgtgcaggctgaccgggtggacaagagtgccgtgggcttcgactaccagggc
aagacggaaaagcacgagtcacagaaagattactcgaagggttttggtggcaagtacggc
attgacaaggataaggtagacaagagtgctgtcggctttgaataccagggcaagacagag
aaacacgagtcccagaaagactacgtgaaaggatttggaggaaaatttggtgtacagaca
gacagacaagacaaatgtgctcttggctgggatcaccaggagaaattgcagctgcacgaa
tcccaaaaagattataaggctggtttcggaggcagatttggtgttcagtccgagaggcag
gactcctgtgctgtggggtttgattacaaggagagactggccaagcacgagtcccagcaa
gactactccaaaggattcggtggaaaatatggggtgcagaaggatcggatggataagaat
gcttccacattcgaggatgtcgcccaggtggcccctgcttatcagaagactgtccctgtc
gaggcagtgaacagcagaacaagtaacatcagagccaactttgaaaacctggctaaggag
aaggagcaggaggacagacggaaggcagaagcggagaaggcccagaggatggcaaaggag
agacaggagcaggaggaggcccggaggcagctgcatgagcaagcccaagcccaggcccaa
aagccaacgccccctgcatccccgactcctcagccagctcaggagaagccgcctccaagc
cctgtctatgagcaggtaatgcctccttatccacatatccacgttgcggatcccctggaa
ctaagaagtagtcgcgtattggtgacctggcatgggccacaggaaatgtctcctgaccct
tcccttccccaggacgcagcttcattcaaggctgagcctgagcccgtgtacagcatggaa
gccgccgactaccaagatgccagcagccagcagggcctggcctatgcccctgatgcagtc
tatgaggccacagagacctcgggccactatcaagcagaggaaaacacctatgacgaatat
gaaaatgaccttgggatcacggccgtcgccctatatgactaccaggctgcgggtgatgac
gaaatctcctttgaccctgatgacatcatcaccaacatagagatgatcgatgatggctgg
tggcgcgggttgtgcaagggcaggtatgggctcttcccagccaactatgtggagctgcgg
ccgtag

DBGET integrated database retrieval system