KEGG   Canis lupus familiaris (dog): 610296
Entry
610296            CDS       T01007                                 

Gene name
CRTAM
Definition
(RefSeq) cytotoxic and regulatory T-cell molecule
  KO
K16361  cytotoxic and regulatory T-cell molecule
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfa04090]
    610296 (CRTAM)
CD molecules [BR:cfa04090]
 Proteins
  610296 (CRTAM)
SSDB
Motif
Pfam: Ig_3 C2-set_2 I-set ig Ig_2 V-set Adeno_E3_CR1 DUF4834 Orf78 Cadherin_C_2 SID-1_RNA_chan Hist_deacetyl
Other DBs
NCBI-GeneID: 610296
NCBI-ProteinID: XP_852857
Ensembl: ENSCAFG00000011705
VGNC: 39630
UniProt: E2QWY2
Position
5
AA seq 393 aa
MWWRLCSLLAWFPLQEAFLTNHTETVTVEEGQTLTLNCVVSPEKTISLQWLAPSGFTIFL
NEHPALQNSKYQLLHHSTNQLSISVLNVSQRDEGVYKCLHYSNSVRTKEVKVMVLATPSM
PTLEASVIRTQNGKEHVTLRCSTVRSKPPPQITWILGNDIELYGETHHEFEMDGKKCNSS
SLLRVHTYGKNSTVNCIIRHKGLQGRKLVAPFRFEDLVTDQETASDAPEKSSPSSQDPQQ
PASTVAVMEDSSTTESDKEEKEQTTQDPDLATEANLQYLGVVRKKNGILLLTLVSFLIFI
LFIIVQLFIMKLRKAHVVWKRENEISEHTLESYKSRSNHEETSSQEKNGQTFHSKSYINY
ITQLYSDAKTKRKENAQNPKLEGEPTHIPESIV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtggtggagactttgcagcttgctggcttggttccccttacaagaagcctttctgact
aaccacacggaaacagtcactgtggaggaaggccagacgctcactctcaactgtgttgtt
tctccagagaagaccatctccctgcagtggctggccccgtcagggttcaccattttttta
aatgagcatcctgctttacaaaattccaaataccagcttcttcaccactccaccaatcag
ctctccatcagcgtgcttaacgtcagccagcgggatgaaggcgtgtacaagtgcttacat
tacagtaactccgtgagaacaaaggaagtaaaagtgatggtgctagcaacaccttccatg
ccaaccctggaagcttcagttatcagaacgcaaaatggaaaggaacacgttacacttaga
tgctccactgtgagaagtaagccccctccgcagataacatggattttagggaatgacata
gagctctatggtgaaacccaccatgaatttgaaatggatgggaagaaatgtaatagcagc
agcctcctcagagtccacacatatggcaaaaactcaacagtgaactgcatcatccgacac
aaaggtctacagggaagaaaactggtagcacctttccgatttgaagatttggtcactgat
caagagacggcttcagatgccccggagaaaagctccccatcctctcaagaccctcagcag
cccgctagtaccgttgcagtaatggaagattctagtacaacagagagtgacaaggaagag
aaagaacaaaccactcaggaccctgacttggccactgaagccaatcttcagtacttagga
gtggtacggaagaaaaatggcattctgctgctcacactcgtgtccttcctgatctttata
ctcttcatcatcgtccagctcttcataatgaagcttcggaaagcacatgtggtgtggaaa
agagaaaatgaaatctcagaacacactctagaaagttacaaatcaaggtcaaatcatgaa
gaaacatcatcccaagagaaaaatggccaaactttccactctaagagctacattaactac
atcacacagttgtactcagatgcaaaaacgaagaggaaggaaaacgcacaaaatccaaaa
ttagaaggagagcccactcatataccagagagcattgtgtag

DBGET integrated database retrieval system