KEGG   Canis familiaris (dog): 610359Help
Entry
610359            CDS       T01007                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin-3 isoform X1
  KO
K04659  thrombospondin 2/3/4/5
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04145  Phagosome
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04512  ECM-receptor interaction
cfa05144  Malaria
cfa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    610359 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    610359 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    610359 (THBS3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    610359 (THBS3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    610359 (THBS3)
   05144 Malaria
    610359 (THBS3)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    610359 (THBS3)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   610359 (THBS3)
  Exosomal proteins of colorectal cancer cells
   610359 (THBS3)
  Exosomal proteins of bladder cancer cells
   610359 (THBS3)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   610359 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 610359
NCBI-ProteinID: XP_003434941
Ensembl: ENSCAFG00000017017
VGNC: 47337
UniProt: E2QYM7
Position
7
AA seq 956 aa AA seqDB search
METQELRGALALLLLCTFASASQDLQVIDLLTVGESRQMTAVAEKIRAALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPAQPNPALQLYVDCKLGDQHAGLPGMAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVTNALQSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCTDINECAHADPCFPGVSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCFPARTCHS
PAHSPCHVHAHCLFERNGAVSCSCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTAMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQERV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctctgcactttcgcatct
gccagtcaggacctgcaggtaattgacctgctgactgtgggcgagtctcggcagatgaca
gctgtagcggagaagatccgggcagccctgctcactgctggggacatctacctcctgtcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctactctcgccaagac
aacacaagatggctggaggcctctgttgtgggcaaaattaacaaagtgctggtacggtac
cagcgggaggatggcaaagtccacgcagtgaacctgcagcaagcaggcctggccgacggg
cggacacacacagctctcctgcgtctccgaggcccggcccaacccaaccctgccctgcag
ctctatgtggactgcaagctgggagaccagcatgctggcctccctggaatggcccccatt
cccccagcagaggtggatgggctggagattcggactgggcagaaggcttatctgaggatg
cagggcttcgtggaatctatgaaaatgattctgggcgggtccatggcccgggtgggagcc
ctgagtgagtgtcccttccagggggacgagtccatccacagtgcagtgaccaatgcgctc
cagtccatcctaggagagcagaccaaggcgctggtcacccagctcaccctcttcaaccag
atcctggtggagctgcgggatgatatccgagaccaggtgaaggaaatgtctctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aacccctgcttccgaggcgtggactgcatggaagtgtatgagtaccccggctaccgctgc
gggccctgcccccctggcctgcagggcaatggcacccactgcactgacatcaatgagtgt
gctcacgctgacccttgcttccctggggtcagctgcatcaacaccatgcctggcttccac
tgtgaagcctgtcctcgaggctacaaaggcactcgtgtgtccggtgtgggcatcgactat
gcccgtgccagcaaacaggtctgcaatgatgtggacgagtgcaacgatgggaacaatggt
ggctgtgacccaaactccatctgcaccaacactgtgggctctttcaagtgtggtccctgt
cgcctgggcttcctgggcaaccagagccagggctgcttcccagcccgcacctgccacagc
ccagcccacagcccctgccatgtccacgcgcactgtctctttgaacgcaatggggcagta
tcctgctcgtgtaatgtgggctgggccgggaatgggaacgtgtgtgggaccgacacggac
attgatggctacccggaccaggccctgccatgcatggacaacaataagcactgcaagcag
gacaattgccttttgacacccaactctgggcaggaagatgctgataatgatggcgtgggg
gaccagtgtgacgatgatgctgacggggatgggatcaagaatgtcgaggacaactgccgg
ctgttccccaacaaggaccagcaaaactctgatacagattcattcggggatgcctgtgac
aactgccccaacgttcccaacaatgaccagaaggacacagacggcaacggggaaggggac
gcatgtgacaacgatgtggatggggacggcatccccaatggattagacaattgtcctaaa
gtccccaaccccctgcagacagacagggacgaggatggggtaggagacgcctgtgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagtgacctggtgggggatgtc
tgtgacaccaatgaggacagtgatggggatggacatcaggacaccaaagacaactgccca
cagctgccaaacagctcccagctggactcagacaatgatggacttggagatgagtgtgat
ggggatgatgacaatgatggggtcccagactatgtgcctcctggtcctgataactgtcgc
ctggtacccaatcccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgattttgacaatgatgcggtggtagatcccctggatgtgtgccctgaaagtgcagag
gtgaccctcacagattttcgagcctatcagactgttgtcctggatcctgagggtgatgct
cagattgatccaaactgggtcgtgctcaatcagggtatggaaatcgttcagaccatgaac
agtgaccccggcctggcagttgggtatacagccttcaatggtgtggactttgaaggcacc
ttccatgtgaacacagtgactgatgatgactacgcaggctttctcttcagctatcaggat
agcggccgcttctatgtggtcatgtggaagcaaacagagcagacctactggcaagccaca
cccttccgggctgtcgctcagcccgggctgcagctcaaggcagtgacatcagtgtccggc
cccggtgaacacctccggaatgccctgtggcatactggccacactcctgatcaggtccga
ctgctgtggactgacccacgaaatgtgggctggcgtgacaagacctcctatcgctggcag
ctgctgcaccggccccaagttggctacattcgggtgaagctctatgagggtcctcagcta
gtggcggattctggggtgatcattgacacagccatgcgaggagggcgtcttggtgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtg
cctgaggattttgagccattccggaggcagctgctccaggaaagagtgtga

DBGET integrated database retrieval system