KEGG   Canis familiaris (dog): 610457Help
Entry
610457            CDS       T01007                                 

Gene name
UBC
Definition
(RefSeq) polyubiquitin-C
  KO
K08770  ubiquitin C
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    610457 (UBC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    610457 (UBC)
Ubiquitin system [BR:cfa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   610457 (UBC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 610457
NCBI-ProteinID: XP_853060
Ensembl: ENSCAFG00000018018
UniProt: J9NVT1
Position
26
AA seq 381 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccttgacgggtaagaccatcaccctggaggtggagcccagt
gacaccatcgagaacgtcaaggcgaagatccaggacaaggagggcatcccccctgaccag
cagaggttgatctttgccggcaaacagctggaagatgggcgcaccctgtccgactacaac
atccagaaggagtccactctgcacctggtccttcgcctcagggggggcatgcagatcttc
gtgaagaccttgacgggtaagaccatcaccctggaggtggagcccagtgacaccatcgag
aacgtcaaggcgaagatccaggacaaggagggcatcccccctgaccagcagaggttgatc
tttgccggcaaacagctggaagatgggcgcaccctgtccgactacaacatccagaaggag
tccactctgcacctggtccttcgcctcagggggggcatgcagatcttcgtgaagaccttg
acgggtaagaccatcaccctggaggtggagcccagtgacaccatcgagaacgtcaaggcg
aagatccaggacaaggagggcatcccccctgaccagcagaggttgatctttgccggcaaa
cagctggaagatgggcgcaccctgtccgactacaacatccagaaggagtccactctgcac
ctggtccttcgcctcagggggggcatgcagatcttcgtgaagaccttgacgggtaagacc
atcaccctggaggtggagcccagtgacaccatcgagaacgtcaaggcgaagatccaggac
aaggagggcatcccccctgaccagcagaggttgatctttgccggcaaacagctggaagat
gggcgcaccctgtccgactacaacatccagaaggagtccactctgcacctggtccttcgc
ctcagggggggcatgcagatcttcgtgaagaccttgacgggtaagaccatcaccctggag
gtggagcccagtgacaccatcgagaacgttaaggcgaagatccaggacaaggagggcatc
ccccctgaccagcagaggttgatctttgccggcaaacagctggaagatgggcgcaccctg
tccgactacaacatccagaaggagtctactctgcacttggtcctgcgcttgaggggaggt
gtctaa

DBGET integrated database retrieval system