KEGG   Canis lupus familiaris (dog): 610506
Entry
610506            CDS       T01007                                 

Gene name
BAG2
Definition
(RefSeq) BAG family molecular chaperone regulator 2
  KO
K09556  BCL2-associated athanogene 2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    610506 (BAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfa03110]
    610506 (BAG2)
Chaperones and folding catalysts [BR:cfa03110]
 Other chaperones and cochaperones
  BAG
   610506 (BAG2)
SSDB
Motif
Pfam: PLAC9 ParD_antitoxin
Other DBs
NCBI-GeneID: 610506
NCBI-ProteinID: XP_853118
Ensembl: ENSCAFG00000028759
VGNC: 38364
UniProt: J9P4C5
Position
12
AA seq 211 aa
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VSKFLDDLGNARSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGSKTLQQNAEGKFN
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcaggccaagatcaacgcgaaagccaacgaggggcgcttctgccgctcctcctcc
atggcggaccgctccagccgcctgctggagagcctggaccagctggagctcagggtggaa
gccttgagagaagccgcaactgctgttgagcaagagaaagaaatcctcctggaaatgatc
cacagcatccagaatagccaggatatgaggcagatcagcgatggagaaagagaagaatta
aatctgacagcaaaccgtttgatgggacgaaccctcaccgttgaagtttcagtagaaaca
atcagaaacccccagcagcaagaatccctaaagcatgccaccaggattattgacgaggtg
gtcagtaagtttctggatgatttgggaaatgccaggagtcacttgatgtccctgtacagt
gcatgttcatctgaggtgccacccgggcctgttgaccagaagtttcagtccatagtaatt
ggctgtgctcttgaagaccagaagaaaattaagagaagattagagaccctgcttagaaat
attgaaaactctgacaaggccatcaagctgttagagcattctaaaggagctggttccaaa
actctgcaacaaaatgctgaaggcaaatttaattag

DBGET integrated database retrieval system