KEGG   Canis familiaris (dog): 610764Help
Entry
610764            CDS       T01007                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X2
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04012  ErbB signaling pathway
cfa04020  Calcium signaling pathway
cfa04024  cAMP signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04114  Oocyte meiosis
cfa04217  Necroptosis
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04310  Wnt signaling pathway
cfa04360  Axon guidance
cfa04713  Circadian entrainment
cfa04720  Long-term potentiation
cfa04722  Neurotrophin signaling pathway
cfa04725  Cholinergic synapse
cfa04728  Dopaminergic synapse
cfa04740  Olfactory transduction
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04916  Melanogenesis
cfa04921  Oxytocin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04925  Aldosterone synthesis and secretion
cfa04934  Cushing syndrome
cfa04971  Gastric acid secretion
cfa05031  Amphetamine addiction
cfa05152  Tuberculosis
cfa05200  Pathways in cancer
cfa05205  Proteoglycans in cancer
cfa05214  Glioma
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    610764 (CAMK2D)
   04310 Wnt signaling pathway
    610764 (CAMK2D)
   04066 HIF-1 signaling pathway
    610764 (CAMK2D)
   04020 Calcium signaling pathway
    610764 (CAMK2D)
   04024 cAMP signaling pathway
    610764 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    610764 (CAMK2D)
   04217 Necroptosis
    610764 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    610764 (CAMK2D)
   04922 Glucagon signaling pathway
    610764 (CAMK2D)
   04912 GnRH signaling pathway
    610764 (CAMK2D)
   04921 Oxytocin signaling pathway
    610764 (CAMK2D)
   04916 Melanogenesis
    610764 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    610764 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    610764 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    610764 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    610764 (CAMK2D)
   04728 Dopaminergic synapse
    610764 (CAMK2D)
   04720 Long-term potentiation
    610764 (CAMK2D)
   04722 Neurotrophin signaling pathway
    610764 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    610764 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    610764 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    610764 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    610764 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    610764 (CAMK2D)
   05205 Proteoglycans in cancer
    610764 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    610764 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    610764 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    610764 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    610764 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    610764 (CAMK2D)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     610764 (CAMK2D)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   610764 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 610764
NCBI-ProteinID: XP_005639344
Ensembl: ENSCAFG00000012059
Position
32
AA seq 544 aa AA seqDB search
MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKKRKSSSSVQMMINNKANVVTSPKENIPTPALE
PQTTVIHNPDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDP
GLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLT
QYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPSCIPNGKENFSGSTSL
WQNI
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccgcaacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggctttctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaaga
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcgacttcatgacagcata
tcagaagagggcttccactatttggtgtttgatttagttactggaggtgaactctttgaa
gacatagtggcaagagagtattacagtgaagcagatgccagtcattgcattcagcagatc
ctggaggctgtgctacactgccatcagatgggcgtagtccatcgggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcgtggtttggttttgctggcacacccggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgttattctctatatcctcctggtgggatatccacccttctgggatgaagatcaacac
agactttatcagcagatcaaggctggagcttatgattttccatcaccagagtgggacaca
gtgactcctgaagccaaagacctaatcaataaaatgctcactatcaaccctgccaagcgt
atcacagcctcagaggcactgaaacacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttaacaactatgctggctacaagaaatttttcagcagccaagagtttg
ttaaagaaaccagatggagtaaagaaaaggaagtccagttcgagtgttcagatgatgata
aacaacaaagccaacgtggtaaccagccccaaagaaaatattcctaccccagcgctggag
ccccaaactactgtaatccacaaccctgatggaaacaaggagtcaactgaaagttcaaat
acaacaattgaggatgaagatgtgaaagcacgaaagcaagaaatcatcaaagtcactgaa
caactgattgaagctatcaacaatggagactttgaagcttacacaaaaatctgtgaccca
ggtcttactgcttttgaacctgaagctttgggtaatttagtggaagggatggactttcac
cgattctactttgaaaatgctttgtccaaaagcaataaaccaatccacacaattatccta
aacccccacgtacacctggtaggtgatgatgctgcctgcatagcatacattaggctcaca
caatacatggatggcagtggaatgccaaagacaatgcagtcagaagagactcgtgtgtgg
catcgccgggatggaaagtggcagaatgttcattttcatcgctctgggtcaccaacagta
cccatcaagccatcctgtattccaaatgggaaagaaaacttctcaggaagcacctctttg
tggcaaaacatctaa

DBGET integrated database retrieval system