KEGG   Canis familiaris (dog): 610895Help
Entry
610895            CDS       T01007                                 

Gene name
PAG1
Definition
(RefSeq) phosphoprotein associated with glycosphingolipid-enriched microdomains 1
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: PAG Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 610895
NCBI-ProteinID: XP_005638130
Ensembl: ENSCAFG00000008430
VGNC: 44242
UniProt: E2QXY0
Position
29
AA seq 433 aa AA seqDB search
MGPSEDMLSSGQVQVVLWGSLATVATFFLISFLIFLCSSCDREKKPRQHSGDHENLMNVP
SDKEMFSRSVTSLATDAPASSEQNGILTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQD
STGKPKCHQSRELPRIPPDSAVDTTLSTRSGDGDQGLGMEGPYEVLKDSSSQENMVEDCL
YETVKEIKEVATAVNPGRGQSSRSKSTSALKELPGPQAPQADFAEYASVDRNKKCRQSVN
AETVLGDSCDVEEEAPPPVPVKLLDENENLQEKEESKTEEGATEGTSDTNKRFSSLSYKS
REEDPTLTEEEISAMYSSVNKPGQSGNKSGQTLKAPESAYTSIQRATQRSPSSCNDLYAT
VKDFEKTPNSVSTLPPAARPGEEPEPDYEAIQTLNREEEKATPETNGQRGLFPKENDYES
IGDLQQGRDITRL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggaccctcggaggacatgctgagcagcgggcaagtgcaggtcgtcctgtggggcagc
ttggccaccgtggccacattcttcctcatcagcttcctcatcttcctgtgctccagttgt
gacagagaaaagaagccgaggcagcatagcggggatcatgagaacctgatgaatgtgcct
tccgacaaggagatgttcagccgttcggtgaccagcctggccacagatgcacctgccagc
agcgagcagaacgggatactcaccaatggcgacattctttcagaagacagtactctgacg
tgcatgcaacattatgaggaggtgcagacgtcagcttcagatctgctggactcccaggac
agcacggggaagccgaaatgtcatcagagccgggaactgcccagaattcctcctgacagt
gccgtggacacgacgctcagcacgaggagcggggacggggaccaaggcctggggatggaa
gggccatatgaagtgctgaaggatagttcctcccaagaaaacatggtggaggactgcttg
tatgagactgtgaaagaaattaaggaggtggccacagctgtgaacccagggagaggccag
agcagcagatcgaagtcgacttccgccttgaaagagcttccagggccccaagctccccaa
gcagactttgctgaatatgcctcggtggacagaaacaaaaagtgtcgacagagtgttaat
gcagagaccgttctcggagattcgtgtgatgtggaagaggaggccccaccacctgtccct
gttaaacttctggacgaaaacgaaaacctccaggagaaggaagagagtaagaccgaagaa
ggagccacagaggggaccagtgacaccaacaagagatttagttcattgtcatacaagtcc
cgggaagaggacccaactctaacagaagaagagatctcagccatgtattcatcagtaaat
aaacctggacagtcagggaataaatcaggacagacccttaaggcaccagagtccgcctac
acctccatccaaagagccactcagagatccccctcttcctgtaatgatctctatgctact
gttaaagactttgagaaaaccccaaacagtgtcagcacgcttccaccagcagcgagaccc
ggtgaggagcctgagcctgattatgaagcaatacaaactctaaacagagaggaagaaaag
gccaccccagagaccaacggccagcgcggccttttcccgaaggagaatgactatgagagc
attggggacttgcagcaaggcagggatatcaccaggctctag

DBGET integrated database retrieval system