KEGG   Canis familiaris (dog): 611124Help
Entry
611124            CDS       T01007                                 

Gene name
CAMKK1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1 isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    611124 (CAMKK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    611124 (CAMKK1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     611124 (CAMKK1)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: Other
  CAMKK family
   611124 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DHDPS
Motif
Other DBs
NCBI-GeneID: 611124
NCBI-ProteinID: XP_022279200
Ensembl: ENSCAFG00000019377
VGNC: 38683
Position
9
AA seq 431 aa AA seqDB search
MEGGPAVCCQDPRADLVERVAAIDVAHLEEAGGGPEPARNGVDPLPRTRAASVIPGGASR
TPLVRPSLSARKFSLQERPAGSCLEAQGGPYATGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
ATSGGSAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLGRSWRFPVTNPS
RRSKLVSTCGTSSWALSTALDVWATGVTLYCFVYGKCPFIDDYILALHRKIKNEAVVFPE
EPEVSEELKDLILKMLDKNPETRIGVPDIKVHPWVTKGGEEPLPSEEEHCSVVEVTEEEV
KNSIKLIPSWTTVILVKSMLRKRSFGNPFEPQARKEERSMSAPGNLLSKDRCGEGGKSLE
LPGVQEDEAAS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaggggggcccagcagtctgctgccaggacccccgggcagacttggtggagcgagtg
gcagccattgatgtggcccacctagaggaggcaggtggtggcccagagcctgccagaaat
ggtgtggaccctctgccaaggaccagagctgcctccgtgatccctggtggtgcttcaaga
actcccctagtccggcccagcctctcagctaggaagttctccctgcaagagcggccagca
ggaagctgcctggaggcccagggtgggccttacgccactgggcctgccagccacatctcc
ccacgggcctggcggaggcccaccattgagtctcaccatgtggccatctcagatgcagag
gactgtgtgcagctgaaccagtacaagctacagagtgagattggcaagggtgcctacggc
gtggtgaggctggcctacaacgaaagtgaagacaggcactatgcaatgaaagttctttcc
aaaaagaagttactgaagcagtatggctttccacgtcgccctccccccagagggtcccaa
gccacctcaggaggatcagccaagcagctactgcctcttgagcgcgtgtaccaggagatt
gccatactgaagaagctggaccacgtgaatgtggtcaagttgattgaggttttggatgac
ccagctgaggacaatctctatttgggccggtcatggaggttcccagtgacaaacccttcc
cggaggagcaagctcgtctctacctgcgggacatcatcctgggccttgagtactgccttg
gatgtatgggccaccggggtcacgttatactgctttgtctatggaaagtgcccattcatc
gatgattacatcctggccctgcataggaagatcaagaatgaggccgtggtgtttcctgag
gagccagaggtcagtgaggagctcaaggacctaatcctgaagatgctagacaaaaatcct
gaaacaagaattggggtgccagacatcaaggtgcacccctgggtgaccaaaggtggggag
gagccccttccctcggaggaggagcactgcagtgtggtggaggtgacggaagaggaggtg
aagaattcaatcaagctcatccccagctggactacagtgatcctggttaagtccatgctg
agaaagcgttcctttgggaatccatttgaacctcaagctcggaaggaagagcgatctatg
tctgctccaggaaacttactgtcgaaagacaggtgtggtgaagggggcaagagcctggag
ctccccggcgtccaagaagatgaggctgcatcctga

DBGET integrated database retrieval system