KEGG   Canis lupus familiaris (dog): 611198
Entry
611198            CDS       T01007                                 

Gene name
AGRP
Definition
(RefSeq) agouti-related protein
  KO
K05231  agouti related protein
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    611198 (AGRP)
SSDB
Motif
Pfam: Agouti Toxin_9
Other DBs
NCBI-GeneID: 611198
NCBI-ProteinID: XP_853932
Ensembl: ENSCAFG00000020359
VGNC: 37717
UniProt: E2RJQ9
Position
5
AA seq 132 aa
MLPAVLLSCALLLALPPMQGAQIGLVPLEGIRRPDQALFPELPGLGLQSSLKRATAEQSE
EALLQEAEALAEVLDPEGREPRSPRRCVRLHESCLGHQVPCCDPCATCYCRFFNAFCYCR
KLGTATNPCSRT
NT seq 399 nt   +upstreamnt  +downstreamnt
atgctgcctgcagtgctgctgagctgtgccctgcttctggcactgccgcccatgcagggg
gcccagattggcttggtccccctggaaggcatcagaagacctgaccaggctctgttccca
gagcttccaggcctgggcctgcagtcctccctgaaaagggcaactgcagaacagtctgaa
gaagctctgctgcaggaggcagaggccttggcagaggtactagatccagagggtcgcgag
ccacgctccccgcgtcgctgcgtaaggctgcatgaatcctgtctgggacaccaggtgccg
tgttgcgacccatgtgccacgtgctactgccgtttcttcaacgccttctgctactgccgc
aagctgggtactgccacgaacccctgcagccgtacctag

DBGET integrated database retrieval system