KEGG   Canis familiaris (dog): 611328Help
Entry
611328            CDS       T01007                                 

Gene name
TMEM150B
Definition
(RefSeq) transmembrane protein 150B
  KO
K21846  transmembrane protein 150
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    611328 (TMEM150B)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    611328 (TMEM150B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frag1
Motif
Other DBs
NCBI-GeneID: 611328
NCBI-ProteinID: XP_013974091
Ensembl: ENSCAFG00000002595
VGNC: 47482
UniProt: E2QZF2
Position
1
AA seq 234 aa AA seqDB search
MWGYLSLLPAFLALWAITGVWTVFALAVANRSVNLTEGFPYISLCGSYPPQSCIFSQLLN
MGAAMAAWICIIRYHQLRDWGVGRWFNQVILWTGLLCALGTSVVGNFQQKNQLPVHLTGA
FFALFVGNLYFWLQLFLFWWMKSLPQPGAPWIRPLRLGLCSLCTILMVAMVILHHWPLRS
ASAACEWAIAMLLFMLFGLFAVDFSCLDGCTLCLQPGPSLSPPPASPISLQVPL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtggggctacctgtccctgctgcctgccttcctggccctctgggctatcactggagtc
tggaccgtttttgccctggccgtagccaacaggtctgtgaacctcaccgaaggttttccc
tacatcagcctctgtggatcttacccccctcagagttgcatcttcagccagctgctcaac
atgggagctgctatggccgcctggatctgcatcatccgttaccaccagctccgggactgg
ggagtcggaagatggtttaaccaggtgatcctgtggacggggcttctgtgtgccctgggc
acctccgtggtgggcaatttccagcaaaagaaccagctgcccgtacatctgacaggggcc
ttctttgccttattcgtgggcaacctgtacttctggctgcagctctttctcttctggtgg
atgaagagcctgccccaacctggggccccctggatcaggccactccgcctgggcctctgc
agcctctgcaccatcctcatggtggccatggtcatcctccaccactggccgctgcgctcg
gcctccgctgcctgcgagtgggccatcgccatgctgctgttcatgctcttcggcctgttt
gcggtggatttttcctgcctggacggctgcaccctgtgtctccagccgggccccagcctc
agccccccaccggcctcccccatctccctgcaggtccccctgtga

DBGET integrated database retrieval system