KEGG   Canis lupus familiaris (dog): 611509
Entry
611509            CDS       T01007                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04260  Cardiac muscle contraction
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04921  Oxytocin signaling pathway
cfa05410  Hypertrophic cardiomyopathy
cfa05412  Arrhythmogenic right ventricular cardiomyopathy
cfa05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    611509 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    611509 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    611509 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    611509 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    611509 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    611509 (CACNG7)
   05414 Dilated cardiomyopathy
    611509 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    611509 (CACNG7)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   611509 (CACNG7)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 Amastin L_HMGIC_fpl Serinc DUF4064 DUF6336
Other DBs
NCBI-GeneID: 611509
NCBI-ProteinID: XP_854277
Ensembl: ENSCAFG00000029738
UniProt: J9NRM3
Position
1
AA seq 275 aa
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctaagcagcgtgtttggtgcgtgtggc
ctgctgctcgtgggcatcgcagtcagcactgattactggctgtacatggaggagggaacg
gtgttgccacagaaccagaccacggaggtcaagatggcactgcacgctggcctctggcga
gtctgcttcttcgcaggccgggagaagggtcgctgtgtggcctcggaatatttccttgaa
ccagagatcaacttggtgacggaaaacacggagaatattctgaagacggtgcgcacggcc
actccgttccccatggtcagtctcttcctagtgttcaccgccttcgtcatcagtaacatc
ggccacatccgccctcagaggaccattctggccttcgtttctggcatcttcttcatccta
tctggcctctccttggtggtgggcttggttctctacatttccagcatcaatgatgaggtc
atgaacaggcccagcagttctgagcagtatttccactatcgctacgggtggtcttttgcc
ttcgctgcttcatccttcctactcaaagagggggctggcgtcatgtcggtgtacttgttc
accaagcgctacgcagaggaggagatgtaccgcccgcacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagtttctgcagcccgaggcgtggcgccggggc
cgcagcccctccgacatctccagcgacgtctccatccagatgacgcagaactaccctccc
gccatcaagtacccggaccacctgcacatctccacctcgccctgctga

DBGET integrated database retrieval system