KEGG   Canis lupus familiaris (dog): 611571
Entry
611571            CDS       T01007                                 
Symbol
CD247
Name
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform X1
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04650  Natural killer cell mediated cytotoxicity
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa05142  Chagas disease
cfa05169  Epstein-Barr virus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    611571 (CD247)
   04660 T cell receptor signaling pathway
    611571 (CD247)
   04658 Th1 and Th2 cell differentiation
    611571 (CD247)
   04659 Th17 cell differentiation
    611571 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    611571 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    611571 (CD247)
   05169 Epstein-Barr virus infection
    611571 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    611571 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    611571 (CD247)
   04090 CD molecules [BR:cfa04090]
    611571 (CD247)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   611571 (CD247)
CD molecules [BR:cfa04090]
 Proteins
  611571 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta P53_tetramer
Other DBs
NCBI-GeneID: 611571
NCBI-ProteinID: XP_038423636
Position
7:30436526..30511145
AA seq 229 aa
MNRKGECELLGPVGRCLSSHQPHSPPLPEEAGAEQRRQPPFLFCVPAMAATALASWHHPG
GKDKMMWKMLVITALLQAQLPVTGAQSLGLLDPKLCYLLDGVLFIYGVIITALFLRAKFG
RSAAAPEHQQGPNQLYNELNLRGREEYEVLDKRRGLDPEMGGKQRKRNPQEVVYNALQKD
KMAEAYSEIGIKSENQRRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaaccgaaagggggagtgtgaacttcttggccctgttggcaggtgtctatcttctcac
cagccccacagtcctccacttcctgaggaggcaggagcagaacaaaggcggcagcctcct
tttctcttctgtgtcccagccatggctgccacagccttggcctcctggcatcatcctggg
ggaaaggacaagatgatgtggaagatgctggttatcacggccctgctgcaggcacagctc
ccggtgacaggggctcagagcttaggcctgctggatcccaaattgtgctacctgctggat
ggagtcctcttcatctatggtgtcattatcactgctctgttcctgagagcaaagttcggc
aggagcgcggccgcccccgagcaccagcagggccccaaccagctctacaacgagctcaat
ctgcgaggaagagaggagtacgaggttttggataagagacgcggcctggacccggagatg
ggaggaaagcagaggaagaggaaccctcaggaggtcgtgtacaatgcactgcagaaagac
aagatggcagaggcctacagtgagattgggataaaaagcgagaaccagcgtcggagaggg
aaggggcatgatggcctttaccaggggctcagcacggccaccaaggacacctatgatgcc
ctccacatgcaggccctgcctcctcgctaa

DBGET integrated database retrieval system