KEGG   Canis familiaris (dog): 611584
Entry
611584            CDS       T01007                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X3
  KO
K15195  AF4/FMR2 family member 3
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    611584 (AFF3)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     611584 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 611584
NCBI-ProteinID: XP_005626071
Ensembl: ENSCAFG00000023079
VGNC: 37687
Position
10
AA seq 1249 aa
MNICWNEHINCTLFCLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERRN
QETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVP
KPGVPQAPVNKIDEHFAADSRAQAQPSSVCSTASSTPAAVPVQQSKRGTMGWQKAGHPPS
DGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNF
PPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETGVHCTSYRGVPATKPESAR
AKAKLSKLSIPKQGEESRSGDTNSCVEEIIREMTWLPPLSAIPAPGKVEPSKFPFPNKDS
QLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALHALSDST
VVQQANCRASVPSSKGSSSGSSSSGSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSP
EAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYAPAKEEVQDCAKLADVCQA
SLRDKDIKSACKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSAAAQPPAAPGAPAAEST
PAPARRAAGKKPTRRTDRTAAGDATNCHRPEEPAAADALGASVVGPPEPAKTRPCGNSRT
SHRKELRSSVTCEKRRTRGLSRIVPKSKEFIDTESSSSSSSSDSDLESEQEEYPLSKAQA
VAAAASSASDQRLKEAAGPISSGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNEL
LSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLNAPAAKDAESTQPSHPSDAPAEKA
LPKSKRKRKCDNEDDYREVKKAQGEKESSSRLTTSANNTLSANHCSMNINSLAIPINKNE
KVLRSPISPLSDASKHKYSSEDLTSSRSNGNFTSASSNKKHKAESQLQSHAGDLTKAAHN
NSENVLHKPRPQTEPWSPGSNGHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEK
FGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPED
KQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTP
SPMSPNPSPTSSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEM
ADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgaacatctgctggaacgagcatattaactgcactctgttctgcctctggggtgaagac
atcttaaaccagaggaatgactctctagttgtggaatttcagtcttccgccagcagatgc
aggagcgtctatgaaccagatagaaatgtgttacgaaggaaggaacgagagagaagaaat
caggaaacacagcaggatgatggcacatttaattcgagttactccctcttcagtgaacct
tataagactaacaagggggatgagctctccaaccggatccagaatactttaggcaattac
gatgaaatgaaagactttttaactgatcgatctaatcagagtcatcttgttggcgttccc
aaacctggggttcctcaggctcccgtgaacaagatcgatgaacattttgctgcagattca
agagcccaggcccagccctcatctgtctgtagcactgcttcttccacaccagcagctgtc
cccgtgcagcagagtaagagaggcaccatgggctggcagaaggccgggcatccgccatca
gatggccaacagagagcaacacaacaaggctctctcaggaccttgcttggagatggtgtt
ggcagacagcagccacgagccaaacaagtgtgcaatgtagaggtgggtcttcagacccag
gaaaggccacctgctatggcagccaagcatagcagcagcggacactgtgttcagaacttt
cctccatccctggcttcaaaacccagcctggtccagcagaaaccaactgcatatgtgcgg
ccgatggatggccaagatcaagctcccgacgagtctccaaagcttaagtcgtccacagaa
acgggtgtgcactgcacctcatacaggggagtcccggccaccaagccagagtctgccaga
gccaaggccaaactttccaagttaagcatccccaaacaaggagaggagagtagatctgga
gacacaaacagctgtgttgaagaaataattcgggagatgacctggctcccaccactttct
gctattccagcacctggaaaagtggaaccaagcaaatttccatttccaaataaggactct
cagcttgtttcctccggacacaataatccaaagaaaggtgatgctgagccagagagtcca
gacaatggcacatcgaatacatcaatgttagaagatgaccttaagctaagtagtgatgaa
gaggagaatgaacagcaggcagcccagagaactgctctccacgctctgtctgacagcacc
gtggtccagcaggccaactgcagagcctctgtgccttccagcaagggcagcagcagtggc
agtagcagcagcggcagcagctcctccagtgactcagagagcagctctggatctgactcg
gagaccgagagcagttccagcgagagtgagggcagcaagcctccccactactccagcccc
gaggctgaaccagcgtcctctaacaagtggcagctggacaaatggctaaacaaagttaat
ccccacaagccgcctattctgatccaaaatgagagccacgggccagagagcaatcaatac
tacgctcctgcgaaagaggaagtgcaggactgtgcgaagctggccgacgtttgccaagcc
agcctgcgagacaaggacatcaagagcgcctgcaaggaggagcagaggccaaggactgcg
aacaaggccccggggagcaagggagtgaagcagaagtcgccgcccgccgccgtggccgtg
gccgtgagcgcagccgcccagccgcccgccgcgcccggtgcgcccgccgccgagagcaca
cctgcgcctgcccggagggccgcgggcaagaagcccacccggcgcaccgacaggaccgcc
gccggcgacgccaccaactgccaccggcccgaggagcccgcggctgccgacgcgctgggg
gcgagcgtggtgggccccccggagcccgccaagaccaggccctgcggcaacagcagaacg
agccaccgcaaggagctgcgctcctcggtgacctgcgagaagcgccgcacgcgggggctg
agcaggatcgtccccaaatccaaggagttcatagacacagaatcctcctcttcctcctcc
tcctcggactcggacctggagtccgagcaagaggagtaccctctgtccaaagcgcaggcc
gtggccgccgccgcctcctcggcgagtgaccagaggctgaaggaggctgcgggccccatc
agcagtggcggcggcccccgggcccccgtaggctccatcaacgccaggaccaccagcgac
attgccaaggagctggaggagcagttctacacgctcgtcccttttggccgcaacgaactt
ctctcccccttgaaggacagcgatgaggtcaggtctctctgggtcaaaattgacctgacc
ctgctgtccaggatcccagaacacctgccccaggagcccggggtcttgaatgcccctgcg
gccaaggacgccgagagcacgcagccaagccatccgtctgacgctcctgccgaaaaggct
ttgccaaaatccaagaggaaacgcaagtgtgacaatgaagatgattacagggaggtcaag
aaggcccagggagagaaagagagctcttcgcgactgaccacctctgccaataatacttta
tctgcaaaccattgcagcatgaacatcaacagcttggcaataccaataaataaaaatgaa
aaagtgctccggtcacccatctcacccctctctgatgcatctaaacacaaatactccagc
gaggacttaacttctagcagatcaaatggcaacttcacttctgcttcctccaacaaaaag
cataaggctgagagccagctgcagtctcatgctggagacctcacgaaagctgctcacaac
aattccgaaaacgttctccacaagccacggccacaaacagagccatggtctccaggttcc
aacggccacagggattgcaagaggcagaaacttgtcttcgatgatatgccacgcagtgca
gattattttatgcaagaagctaaacggatgaagcataaagcagatgcaatggtggaaaag
tttggaaaggctttgaactatgctgaagcagctttgtcatttattgagtgtggaaatgca
atggaacaaggcccaatggaatccaaatctccttatacaatgtattcggaaacagtagag
ctcatcaggtatgctatgagactaaaaactcattcaggccccaatgccacaccagaggac
aaacaactggctgcattatgttaccgctgcctggctctcctgtactggcggatgtttcga
ctcaaaagggaccatgctgtgaagtattcaaaagcacttattgactatttcaagaattca
tctaaagctgcccaagccccatctccatggggagccagtggaaagagcactggaacccca
tcccctatgtctcccaacccctccccaaccagctccgtgggatctcaggggagcctctcc
aacgccagcgccctgtccccttcaaccatcgtcagcatcccacagcgcatccaccagatg
gcagccaatcacgtcagcatcaccaacagcattctccacagctatgactactgggagatg
gcagacaacctggccaaggaaaacagagaattcttcaatgacctggatttgctcatgggg
cctgtcaccctgcacagcagcatggagcacctggtccagtactcccagcagggtctgcac
tggctgcggaacagcacccacctgtcatag

DBGET integrated database retrieval system