KEGG   Canis lupus familiaris (dog): 611852
Entry
611852            CDS       T01007                                 

Gene name
TICAM1
Definition
(RefSeq) TIR domain-containing adapter molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04064  NF-kappa B signaling pathway
cfa04217  Necroptosis
cfa04620  Toll-like receptor signaling pathway
cfa04621  NOD-like receptor signaling pathway
cfa05133  Pertussis
cfa05135  Yersinia infection
cfa05142  Chagas disease
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05164  Influenza A
cfa05165  Human papillomavirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05168  Herpes simplex virus 1 infection
cfa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    611852 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    611852 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    611852 (TICAM1)
   04621 NOD-like receptor signaling pathway
    611852 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    611852 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    611852 (TICAM1)
   05133 Pertussis
    611852 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    611852 (TICAM1)
   05160 Hepatitis C
    611852 (TICAM1)
   05164 Influenza A
    611852 (TICAM1)
   05168 Herpes simplex virus 1 infection
    611852 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    611852 (TICAM1)
   05165 Human papillomavirus infection
    611852 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    611852 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 611852
NCBI-ProteinID: XP_005633080
UniProt: F1PI49
Position
20
AA seq 751 aa
MACADLSLSSAFDILGAAGQDKLLRLKHKLKTLRLGCRGADLLHAMVLLKLGRETEARIS
LEALKADAVARLVAHQWAGMDGAEAPKEPPDLSWAVARVYHLLTEENLCPATMRDLAYQA
ALRTFSSRDDHRLAELQGEARDRCGWGIVGDPGSFQPLHSDLGCLPASSVSPSGARSLPK
PIEDPSAWSRGRSLRSTGSPASLASNLEISESPTMPFLSRHRSCHEPSKLCDEPQASLVP
EPAPTGCQEPEEVSWPPSEETASPPPEETASPPRGETSSPPPEEMASSSPGETASPSLEE
TASPSSGEVASPSSGETASPGMLPNSPVPTPPPDVVPDASLSDQLDPPKAGQMGTHYPVE
CTEMLAAPSSLSLPSGNARPVKDQTPLPLPVEDTASQLPNPSPPPPSALRTSPPCPFPST
SPSTGPVPSHPCPPSPNSPELESEQKFYNFVILHAAADEHIALRVRERLEALGVPDGATF
CEDFQVPGRGELRCLQDAINHSAFTILLLTPNLNCRLGLHQVSQSLMSSLTRHGWQDCVI
PFLPLESSQAQLSRDTCSLLSSLVWLDEHSRVFARRVVNTFKAQQLRARKAQWKKEQDIR
ALQQQRQHLEGERQQVASLSAAYSAYLQSCSSWQAQMEALRAAFGSHMPFGAQGPYGGPG
PLGAPPPLPSWLGHQPPAAPPWLAGSPAPAFPPAPAFPQPPAFSPPPAPPQSPGLQPLII
HHAQMVQLGVNNHMWNQRGTQAPEDETQGAE
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggcctgcgcggacctgtcgctctccagcgcctttgacattctaggtgccgcaggccag
gacaagctcttgcgtcttaagcacaagctaaagaccctgcgcctgggctgccggggggca
gacctcctgcacgccatggtgctcctgaagctgggccgggagacggaggccaggatctcc
ctggaagcactgaaggcggacgcggtggcccggcttgtggcgcaccagtgggccggcatg
gatggtgccgaggcccccaaggagccaccagacttgtcctgggcagttgcccgggtgtac
cacctgcttaccgaggagaacctgtgcccggccacgatgcgggacctggcctaccaggcg
gccctccggaccttcagctctagggatgaccaccggctggccgagctccagggagaggcc
cgggaccggtgtgggtggggcatcgtcggggacccggggagcttccagccccttcactcc
gatctgggctgcctcccagcatcctcagtgtcaccctcaggcgcccgcagccttccaaag
cccatagaggacccctcggcctggagccgaggccgttccctgagatccaccggcagccca
gcctccctggccagcaatctggaaatcagcgagtcgcccaccatgccctttctcagccgt
caccgcagctgccatgaacccagcaagctgtgcgacgagccccaggccagcctggtgccc
gagcctgcccccacgggctgccaggagcctgaggaggtgagctggccaccatcagaagag
actgccagccccccaccagaggagacggccagccccccacggggggagacttccagcccc
ccaccagaggagatggccagctcctcaccgggggagacagccagcccctcactggaagag
actgccagcccctcctctggggaggttgccagcccctcatcgggagagactgccagcccc
gggatgctaccaaacagcccagtccccacgccgcctcctgacgtggtcccagatgcaagc
ctcagtgaccagctcgacccccccaaagcggggcagatgggcacccactaccccgtggaa
tgcactgaaatgttggcagcccccagctctctgtccttgccctctggaaatgctcgccct
gtcaaggaccagaccccactcccacttcctgtagaagacaccgcttcccagttgcccaac
cccagcccacctcctccctcagccctgaggacgtcccctccctgcccttttccatccacc
tctccttccactggcccggtcccctcgcacccctgtccaccttctccaaattctcccgaa
ttggagtcggaacagaaattctataactttgtgatcctgcacgcggcggcggacgagcac
atcgccctgcgggtccgggagcggctggaggccctgggcgtccccgacggtgccaccttc
tgcgaggacttccaggtgcccgggcggggcgagctgcgctgcctgcaggacgccatcaac
cactcggccttcaccatcctgctgctcacccccaacctcaactgccgcctgggcctgcat
caggtgagccagtcgctgatgagcagcctcacgcggcacgggtggcaagactgcgtgatc
cccttcctgcccctggagagctcccaggcccagctcagccgggacacgtgcagcctgctc
agcagcctggtgtggctggacgagcactcccgggtcttcgccaggagggtggtcaacacg
ttcaaggcgcagcagctgcgagcccgcaaggcccagtggaagaaggaacaggacatccgg
gccctgcagcagcagcgccagcacctggagggtgagcggcagcaggtggcctcgctgagc
gccgcctactccgcctacctccagagctgctcgtcgtggcaggcgcagatggaggcgctc
cgggcggccttcgggagccacatgccatttggggctcaggggccctacgggggcccgggg
cctctgggggcccccccgcccctcccctcctggttgggccaccagcctcccgccgcgccg
ccgtggctggccggctcgcccgcgcccgccttcccgcccgcgcccgccttcccgcagccc
cccgccttctcgccgccccccgcgcccccgcagagcccggggctgcagcccctcatcatc
caccacgcgcagatggtgcagctgggcgtcaacaaccacatgtggaaccagcgagggacc
caggcgcccgaggacgagacgcaaggagcagagtga

DBGET integrated database retrieval system