KEGG   Canis lupus familiaris (dog): 612102
Entry
612102            CDS       T01007                                 

Gene name
BCAN
Definition
(RefSeq) brevican core protein precursor
  KO
K06795  brevican
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    612102 (BCAN)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    612102 (BCAN)
   04091 Lectins [BR:cfa04091]
    612102 (BCAN)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   612102 (BCAN)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   612102 (BCAN)
Lectins [BR:cfa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   612102 (BCAN)
SSDB
Motif
Pfam: Xlink Lectin_C V-set Sushi EGF hEGF EGF_2 ig I-set Ig_2 Izumo-Ig EGF_3
Other DBs
NCBI-GeneID: 612102
NCBI-ProteinID: NP_001271366
Ensembl: ENSCAFG00000016712
VGNC: 38395
UniProt: H6VX53
Position
7
AA seq 915 aa
MAPLFLPLLVALALARGPVALADALEGDSSEDRAFHVRIAGDAPLQGVLGGALTIPCHVH
YLRPLPGHRAVLGSPRVKWTFLSGGREAEVLVARGLRVKVSEAYRFRVALPAYPASLTDV
SLVLSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACA
RIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGAPPDKLTLEEARAYCRERGAEIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AMPEASDPASDPASDGLEAIVTVTETLEELRLPQEAVESESRGAIYSIPIVEDGGGRSST
PEDPAEAPKTLLEFETQSIVPPLGSSEEEDKTLEEEEKYTDEEEEKEEEEVEDEALWAWS
SEPSSPDPQTPLPTEPALEELLFPASPPPASAVLQPRPSPPSDREPEAPRPPRVLGPPTE
TLSTPRNGQLASSPPSATAGEREVGEEAGGPELTGVPRGESEETGSSEDSPALLPATRAP
ESARESEAPSEENSGRTVPAGTSVRVQPVLPTDSASQGGVAVAPSSGDCVPSPCHNGGTC
LEEEEGVRCLCLPGYGGDLCDVGLRFCSPGWDAFQGACYKHFSTRRSWEEAETQCRMYGS
HLASISTPEEQDFINSRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSG
ENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLARVFGRPRLRYEVDTVLR
YRCREGLMQRNLPLIRCQENGHWEPPQISCVPRRPGRALHPMKASGGQQGRLLGRWQAPR
MPPSRPSLGPQGARP
NT seq 2748 nt   +upstreamnt  +downstreamnt
atggcccccctgttcctgcccctgctggtagccttggccctggcccggggccctgtggcc
ttagctgatgccctggaaggggacagctcagaggaccgggccttccacgtgcgcatcgcg
ggtgacgcaccactgcagggcgtgctgggcggcgccctcaccatcccttgccacgttcac
tacctacggccgctgccgggccaccgggccgtgctgggctccccgcgggtcaagtggacc
ttcctgtccgggggccgtgaggccgaagtattggtggctcgggggctgcgcgtcaaggtg
agcgaggcctaccgtttccgtgtggcactgcctgcctacccggcatcactcaccgacgtg
tccctggtgctgagtgagcttcggcccaacgactccggcatctaccgctgcgaggtccag
cacggcatagatgacagcagcgatgccgtggaggtcaaggtcaaaggggtcgtctttctc
taccgggaaggctctgcccgctatgctttctctttcgctggggcccaggaggcctgtgcc
cgcattggagcccgcattgccaccccggagcagctctatgccgcctacctcgggggctat
gaacagtgtgatgctggctggctatctgaccagaccgtgaggtatcccatccagacacca
cgagaggcctgttatggagacatggatggcttccctggggtccggaactatggagtggtg
gacccagatgacctctatgatgtctactgctatgctgaagatctaaatggagagctgttc
ctgggtgcccccccagacaagctgacgttggaggaggcacgggcgtactgccgggaacgg
ggtgcagagattgccaccacgggccagctctatgcagcctgggacgggggcctggaccgc
tgcagcccgggctggctggccgatggcagtgtgcgctatcccattgtcacacccagccag
cgctgcggtgggggcctgcctggtgtcaagacgctcttcctcttccccaaccagaccggc
tttcccaacaagcacagccgcttcaacgtgtactgcttccgagactctgcccagccctcc
gccatgcctgaggcctctgacccagcgtctgacccagcctctgatgggctggaggccatt
gtcacagtgacagagaccctggaggagctgcggctgcctcaggaagctgtggagagcgag
tcccggggagccatctactccatccccatcgtggaggacggaggtggtagaagctccact
ccagaagaccccgcagaggcccccaagaccctcctcgaattcgaaacacaatccattgtg
cctcccctggggtcctccgaagaggaagacaagactttggaggaagaagagaaatatacg
gatgaagaagaagagaaagaagaggaggaggtggaagatgaggccctatgggcctggtcc
agcgagcccagcagcccagacccacagacccctctgcccactgagccagccctagaggaa
ttactcttccctgcctctccaccaccagcgagtgcagtcctacagcctaggccatcacca
ccttccgacagagagccagaggctcccaggcctccaagagtccttgggccacccactgaa
actctatccactcccaggaatgggcagctggcatcctcaccaccttcagctacggctggg
gagagagaggtgggggaggaggctggtggtcctgagctgactggggtccctcgaggagag
agtgaggagacagggagctctgaggatagccctgccctgcttccagccacacgggcccct
gagagtgccagggaatcggaggccccctctgaagagaattctggaagaactgtcccagca
gggacctcagtgcgggttcagccagtgctgcccactgacagcgccagccaaggtggagtg
gccgtggccccctcatcaggtgactgtgtccccagcccctgccacaatggtgggacatgc
ttggaggaggaggagggggtccgctgcctgtgtttgcctggctatgggggggacctgtgt
gatgttggcctccgcttctgcagccctggctgggacgccttccagggggcttgctacaag
cacttctctacccggaggagctgggaggaggcagagacccagtgccggatgtacggctcg
cacctggccagcatcagcacgccggaggaacaggacttcatcaacagtcggtaccgcgag
taccagtggatcgggcttaacgaccggacaatcgaaggcgacttcttgtggtcagatggc
gtccccctgctctatgagaactggaaccctgggcagcctgacagctacttcttgtctgga
gagaactgcgtggtcatggtgtggcacgatcagggacagtggagtgatgtaccctgcaac
taccacctgtcctacacctgcaagatggggctggtgtcctgtgggcctccaccagagctg
cccctggctcgagtgtttggccgcccacggctgcgctatgaagtagacacggtgcttcgc
taccggtgccgggaggggctgatgcagcgcaacctgccactaatccgctgccaggagaat
ggtcactgggagccaccccagatctcctgtgtgccccgcaggcctggtcgggctctgcac
ccaatgaaggcctcaggaggacaacaggggaggctactgggacgctggcaggcaccacgg
atgcctccttccaggccctctcttggtcctcaaggagcaaggccttaa

DBGET integrated database retrieval system