KEGG   Canis familiaris (dog): 612206Help
Entry
612206            CDS       T01007                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00511  Other glycan degradation
cfa00600  Sphingolipid metabolism
cfa01100  Metabolic pathways
cfa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    612206 (GBA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    612206 (GBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    612206 (GBA)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     612206 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 612206
NCBI-ProteinID: XP_855035
Ensembl: ENSCAFG00000016988
VGNC: 41130
UniProt: E2R0I8
Position
7
AA seq 536 aa AA seqDB search
MELSSPPREDRLQPLGRVSIMAASLMGLLLLQAVSCVSGARPCIPKSFGYSSVVCVCNAT
YCDSLDPLALPAPGTFSQYESTRSGRRMELSLGTIRANHTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPPARNLLLKSYFSAEGIEYNIIRVPMASCDFSIRTYTYDDTHDD
FQLHNFSLPEEDIKLKIPLIHQALELAQHPVSLFASPWTSPTWLKTNGAVNGKGSLKGQP
GDLYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLFSGYPFQCLGFTPEHQRDFIA
RDLGPALANSTHHDIRLLILDDQRLLLPHWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVVGWTDW
NLALNLEGGPNWVRNFVDSPIIVDITKDVFYKQPMFYHLGHFSKFIPEGSQRVGLAASKK
NGLDTVALTRPDGSAVVVVLNRSSKDVPLTIKDPAVGFVETLSPAYSIHTYLWRRQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagctttccagtcctcccagagaggaccgtctccagcccctgggcagggtaagcatc
atggctgccagcctcatgggattgcttctacttcaggcagtatcatgtgtatcaggtgcc
cgcccctgcatccctaaaagctttggctacagctcagtagtctgtgtctgcaatgccaca
tactgtgactctcttgaccccctggccctgcctgcccctggcaccttcagccagtatgag
agcacacgcagcgggcgccgaatggagctgagtctggggaccatccgggccaaccacacg
ggcacagggctgctactgaccctgcagccagatcagaagttccagaaggtcaagggattt
ggaggggccatgacggatgcagctgccctcaacatcctcgccttgtcaccccctgcccgg
aatttgctactcaaatcctatttctctgcagaaggaatcgaatacaacatcatccgggta
cccatggccagctgtgacttctccatccgcacctacacctatgatgacacccatgatgac
ttccagttgcataacttcagcctccctgaggaagacatcaagctcaagatacccctgatt
caccaagccctagaactggcccagcaccctgtgtcactcttcgccagtccctggacatca
cccacttggctgaagaccaacggggcagtgaatgggaaggggtcactcaagggtcagcct
ggggatctctaccaccagacgtgggccagatactttgttaagttcctggacgcctatgca
gagcacaagttgcagttctgggcagtgacggcagagaatgagccttccgcagggcttttc
agcggataccccttccagtgcttgggcttcacccctgaacaccagcgagacttcattgcc
cgggacctgggtcctgccctggccaacagtacacaccatgacatccgtctgctcatacta
gatgaccagcgcttgctgctgccccactgggcccaggtggtactggcagacccagaggca
gccaagtacgtccatggcattgctgtacattggtacctggactttctggctccagcgaaa
gccacactgggggagacacaccgcctgttccccaacacaatgctctttgcctcagaggcc
tgtgtgggctccaagttctgggagcagagtgtgcggctgggctcttgggaccgaggggtg
cagtacagccacagcatcatcacgaacctcctctaccatgtggttggctggaccgactgg
aaccttgccctgaacctggaaggagggcccaactgggtgcgcaactttgtcgacagcccc
atcatcgtcgacatcaccaaagatgtgttctataaacagcccatgttctaccaccttggc
cacttcagcaagttcatcccagagggctcccagagagtggggctggcagccagcaagaag
aatggcttggacactgtggcactgacacgtcctgacggctctgcagttgtggttgtgtta
aaccggtcctcgaaggatgtgcctctcaccatcaaggaccctgccgtgggcttcgtggag
acgctctctccagcctactccattcatacgtatctgtggcgtcgccagtga

DBGET integrated database retrieval system