KEGG   Canis familiaris (dog): 612262Help
Entry
612262            CDS       T01007                                 

Gene name
TSPAN12
Definition
(RefSeq) tetraspanin-12 isoform X2
  KO
K17355  tetraspanin-12
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    612262 (TSPAN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin SUR7
Motif
Other DBs
NCBI-GeneID: 612262
NCBI-ProteinID: XP_005628824
Ensembl: ENSCAFG00000003472
VGNC: 47912
Position
14
AA seq 282 aa AA seqDB search
MSISVLAVSAWLRDYLNNVLTLTAETRVEEAVILTYFPVVHPVMIAVCCFLIIVGMLGYC
GTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQEIMVPVQWSDMVTLKARMTNYGLPRY
RWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQ
EGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMILTITLLWALYYDRREPGTDQMMSL
KNDTSQHLSCHSVELLKPSLSRIFEHTSMANSFTTHFEMEEL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcagtgtgttggcagtttctgcttggctgagggactacctaaataatgttctg
actttaactgcggaaacaagggtggaggaggctgtcatcttgacttactttcctgtggtt
catccagtcatgatcgctgtttgctgtttcctcatcattgtggggatgttaggatactgt
ggaacagtgaaaaggaatctgttgcttcttgcatggtacttcggaagtttgctggtcatc
ttctgtgtggaactggcgtgtggcgtttggacctacgagcaggagatcatggtgccagtg
cagtggtccgacatggtcaccttgaaagccagaatgacaaattatggcttacctcgatac
cggtggcttactcacgcttggaattttttccagagagagtttaaatgctgtggagtggtg
tacttcactgactggctggagatgacagagatggactggcccccagattcctgttgtgtt
agggaattcccaggatgttccaaacaggcccaccaggaagatctcagtgacctttaccaa
gagggttgcgggaagaaaatgtattcctttctgagaggaaccaagcaactgcaggtgctg
aggtttctgggaatttccattggagtgacacagatcttggccatgattctcaccatcact
ctactctgggctctctactatgatagaagggagcccgggacagaccaaatgatgtccctg
aagaatgacacgtctcagcatctgtcctgtcactcagtggaactgctgaaaccgagcctg
tcgaggatctttgaacacacgtcaatggcaaacagctttaccacacactttgagatggag
gaattatag

DBGET integrated database retrieval system