KEGG   Canis familiaris (dog): 612435Help
Entry
612435            CDS       T01007                                 

Gene name
CEACAM1
Definition
(RefSeq) carcinoembryonic antigen-related cell adhesion molecule 1 precursor
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    612435 (CEACAM1)
   04090 CD molecules [BR:cfa04090]
    612435 (CEACAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
    612435 (CEACAM1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   612435 (CEACAM1)
  Exosomal proteins of bladder cancer cells
   612435 (CEACAM1)
CD molecules [BR:cfa04090]
 Proteins
  612435 (CEACAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
 Antigens
  612435 (CEACAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set Ig_4 Ig_6 Ig_5 Izumo-Ig Receptor_2B4 DUF4690 C2-set_2 Podoplanin V-set_CD47 VSP Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 612435
NCBI-ProteinID: NP_001091026
Ensembl: ENSCAFG00000014247
UniProt: Q004B2
Position
1
AA seq 521 aa AA seqDB search
MEPPSASPRAGRGPWQELLLAVSLLAFWNPPTTAQVTVESVPPNAAEGKDALLRVLNLPG
DTASLTWFKGETVLPTHKILLYVIDTKITTPGPAYSGRETIYPNGSLLFQNITLNDTGSY
ILQIINQKFETALVRGQLQVFPELHKPSITSNNSNPVENVDSVVLTCESQTQSTSCLWSV
NSKSLPDSPRLELSLDNRTLTVHGVTRNDTGPYECETRNPVSADRSDPFTLNVLYGPDTP
TISPPDSYYRLGANLSLSCRTASNPPAQYSWLINGRPQPSTQELFIPNITAKNSGSYTCS
VYNNATRLNKTTVKTITVSEPVSQPLLTASNTTVTKDDSVVLTCSSNNTGVSIQWFFNGQ
ILTLTDRMKLSQDNSTLTIDPVRKEDAGKYQCEVSNPVSSNKSDPVRLDVEDDSTEQSSG
LPPGAIAGIVIGVVAGVAVIAALVYLQYFRKTGGASDLRDVTEHKPSASNHSQDQSDNLS
NKIEEVAYSSLNFNVQEPKKSTSASSSPAATETVYSEVQKK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggagcccccctcggcctctccccgagcagggcgcggcccctggcaggagctcctgctg
gccgtctcactcttagccttctggaacccgcccaccactgcccaagtcactgtggagtcc
gtgcctcccaatgctgctgaagggaaggacgctcttctgcgggtcctcaatctgcctggg
gatacagcaagccttacctggttcaaaggggaaactgtattgccgacccataaaattcta
ttatatgtaatagacaccaaaatcactaccccggggcctgcatacagcggcagagagaca
atataccccaacggatccctgctattccagaacatcaccctgaacgacactggatcctac
atcctacaaatcataaaccaaaaatttgaaactgcactagtacgtggacagctccaagta
ttcccggagttacacaaacccagcatcacaagcaacaactccaaccccgtggagaatgtg
gattctgtagtgttaacgtgtgaatctcagactcagagcacaagctgcctgtggtcagta
aacagtaagagcctcccggacagtcccaggctggagctgtccctggacaacaggactctc
actgtacatggtgtcacaaggaatgacacaggaccctatgagtgtgaaactcggaaccca
gtgagtgctgatcgtagtgacccattcaccctgaatgttctctatggcccggacacaccc
accatttcccccccagactcctattaccgtctaggggcaaacctcagtctctcctgccgc
acagcttctaacccacctgcacagtattcttggcttatcaatgggaggccccagccatcc
acacaggagctctttatccccaacatcactgcgaaaaatagtggatcctatacctgctcc
gtctataacaatgccacccgcctcaataagaccacagtcaagactatcacagtctctgag
ccagtgtcccaaccccttctcactgccagcaacaccacagtcacaaaagatgactctgtg
gtcctgacctgctcctcaaataacaccggggtctctatccagtggttcttcaatggccag
attctaacgctcacggatagaatgaagctgtcccaggacaacagcaccctcaccatagac
cctgtcaggaaggaggatgccgggaaataccagtgtgaggtctccaacccagtcagttcc
aacaaaagtgaccctgtaaggctggatgtggaagatgattccacagaacaaagttctggc
cttccacctggggctattgccggcatcgtgattggagttgtggctggggttgctgtgata
gcagccctggtgtacttacagtatttcagaaaaactggcggggcaagtgacctgcgtgat
gtcacagagcacaaaccctcagcctccaatcacagtcaggaccagtctgacaatttgtct
aacaagattgaagaagttgcatattcttccctgaacttcaatgtccaggaaccaaagaaa
tcaacttcagcctcctcatccccagcagccacagaaacggtgtattccgaagtacaaaag
aagtaa

DBGET integrated database retrieval system