KEGG   Canis lupus familiaris (dog): 612548
Entry
612548            CDS       T01007                                 

Gene name
KCND1
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 1 isoform X1
  KO
K04891  potassium voltage-gated channel Shal-related subfamily D member 1
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    612548 (KCND1)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   612548 (KCND1)
SSDB
Motif
Pfam: Ion_trans DUF3399 BTB_2 Ion_trans_2 Shal-type BTB_3 PKD_channel
Other DBs
NCBI-GeneID: 612548
NCBI-ProteinID: XP_005641394
Ensembl: ENSCAFG00000015697
VGNC: 42239
UniProt: E2RGW7
Position
X
AA seq 677 aa
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARRPPREQPCGDRFPLAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNEDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQAVGPGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGGASSTLRNSSLGTPCLLPETVKISSLLKSGIISGSLFPS
TVPVELVAAKDVVSISQ
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggcggcgggcgtggccacgtggctgcccttcgccagggcggctgccgtgggctggctg
cccctggcccagcagcccctgccccctgcaccgggagtgaaggcttcccgaggggatgag
gttctggtggtgaacgtgagcggacggcgctttgagacctggaagaacactctggaccgc
tacccagacacactgctgggcagctcggagaaggaattcttctatgacgccgactctggc
gagtacttcttcgatcgtgacccggacatgttccggcacgtgctgaacttctaccgcacg
ggccgactgcactgcccgcggcaggagtgcatccaggccttcgacgaggagctggccttc
tacggcctggtgcccgagctcgtgggcgactgctgcctcgaggagtaccgggaccgcaag
aaggagaacgccgagcgcctggcggaggatgaggaggccgaacaggcgggggacggcccc
gccctgccggccggcagcagcctgcggcagcggctctggcgggccttcgagaacccgcac
acgagcaccgcggccctcgttttctactatgtgacgggctttttcatcgccgtgtcggtc
attgccaacgtggtcgagaccatcccgtgccgcgggcccgcgcggcggcccccaagggag
cagccctgcggcgaccgcttccccctggcctttttctgcatggacacggcctgtgtgctc
atatttacgggcgagtacctcctgcggctgttcgccgcccccagccggtgccgcttcctg
cggagtgtgatgagcctcatcgacgtggtggccatcctgccctactacattgggctcttt
gtgcccaagaacgaggacgtctcgggtgcctttgtcaccctgcgcgtgttccgggtgttc
cgtatcttcaagttctccaggcattcccagggcttgcggattctgggctacacacttaag
agctgtgcctctgagctggggtttctcctcttttcccttaccatggccatcatcatcttc
gccactgtcatgttttatgctgagaagggcacaaacaagaccaactttactagcatccct
gcggccttctggtataccattgtcaccatgaccacacttggctatggagacatggtgccc
agcaccattgctggcaagatttttggatccatctgctccctcagtggtgtcctggtcatt
gcactgcctgtgccagtcatcgtgtccaactttagccgcatctaccaccagaaccagcgt
gctgacaagcgccgagcacagcagaaggtgcgcttggcaaggatccggttggcaaagagt
ggtaccaccaatgccttcctgcagtacaagcagaacgggggcctcgaggacagtggcagt
ggggaggaacaggcgctgtgtgtccggaaccgttctgctttcgagcaacaacatcaccac
ctcctgcattgtctagagaagacgacgtgccacgagttcacagatgagctaacctttagc
gaggctctgggtgctgtctcactggggggccgcaccagtcgcagcacctccgtgtcctcc
caggcagtggggcctggcagcctgctgtcctcctgctgcccccgcagggccaagcgccgt
gccattcgccttgccaactccactgcttcagtcagtcgtggcagcatgcaggagctggac
acactggcagggctgcggaggagccctgcccctcagagccgctcaagcctcaatgccaag
ccccatgacagccttgacctgaactgcgacagtcgggactttgtggctgccatcatcagt
atccctacccctccggccaacacgccagatgagagccaaccttcctcccccggtggtggc
ggtggggccagcagcaccctcaggaactccagcttgggcaccccttgcctcctcccagag
actgtcaagatctcttccctgctgaaatcaggcatcatctcaggttccctgttccccagc
actgtccccgtggagctggtggctgccaaagatgtagtttccatcagtcaataa

DBGET integrated database retrieval system