KEGG   Canis familiaris (dog): 612640
Entry
612640            CDS       T01007                                 

Gene name
C4H5orf22
Definition
(RefSeq) UPF0489 protein C5orf22 homolog
Organism
cfa  Canis familiaris (dog)
SSDB
Motif
Pfam: UPF0489
Other DBs
NCBI-GeneID: 612640
NCBI-ProteinID: XP_855465
Ensembl: ENSCAFG00000018933
VGNC: 49202
Position
4
AA seq 450 aa
MLPSGKAAGDAAAGRAGLRRYPALPVWVVEDHQEVLPYIYRAIGSKHLPAGNISFVHFDS
HPDLLIPVNMPADTVFDKETLFGELSIENWIMPAVYAGHFSHVLWLHPPWAQQIREGKHH
FLVGRDTSTTTIRVTSTDHYFLSDGLYVTEDQLENQKPLQLDVIMVKPYKLCNSQEENDA
VSSAKKPKLALEDAENTASSNCDSYSEGLEKDTVTQRRGQTCLEQSCSCFSESQECQTTI
STGEILEILKKGDAFVLDIDLDFFSVKNPFKEMFTQEEYKILQELYQFKKPGTNLTEEDL
VDCVDTRIHQLEDLEAAFADLCDGDNEETVQKWASNPGMESLIPLVQSLKKRMEVPDYEM
VHQAGLTCDYSELPHHISTEQEIEYLIQSVYYLLKNLPKPTLVTIARSSLDDYCPSEQVD
TIQEKVLNVLRSLYGAVDIHLVYLAECSPP
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgctgccgagcgggaaggcggcgggcgacgcggcggcggggcgcgcgggcctgcggcgc
taccccgcgctcccggtgtgggtcgtggaggatcaccaggaggtcctgccttatatatac
cgggccattggctcgaagcatcttcctgccggtaacataagttttgtgcattttgattca
catccagacctccttattcctgtgaatatgccagctgacactgtgtttgacaaggaaaca
cttttcggagaattaagtattgagaattggattatgcctgcagtttatgctggccatttt
tctcatgttctgtggcttcatcccccatgggctcagcaaatcagagagggcaaacatcac
tttttagtaggcagagacacttctactacaacaatcagggttacaagtacagatcattac
tttctaagtgatggtctttatgtaactgaagaccagctagagaaccaaaaacctttacaa
ttggatgtaattatggtaaaaccgtataaactctgtaatagtcaagaagaaaatgatgca
gtgtcttctgctaagaagccaaagctagcactggaagatgcagaaaacactgcctctagt
aactgtgactcctattcagaaggactggaaaaggacacagtgacacagaggaggggccag
acttgcctagaacaatcatgttcatgtttttctgaaagccaagaatgccagactacaatc
agcactggggaaattctggaaattctgaagaaaggggatgcatttgttttagatattgac
ttggattttttttcagtcaagaatcccttcaaagaaatgttcactcaggaagagtacaaa
atcttacaagagttgtaccagtttaaaaagcctggtaccaacctgacagaggaagatttg
gtagattgtgttgatactcgaattcatcagttagaagatttagaagctgcttttgctgat
ttgtgtgatggtgacaatgaagaaactgtacagaaatgggcttcaaaccctggaatggaa
tcactaattccacttgtacagagtttgaaaaaacggatggaagtaccagactatgaaatg
gttcaccaggctggtctaacctgcgattactcagaacttcctcaccatatcagcacagaa
caagaaattgagtatcttattcagtctgtatattatttactgaaaaatttaccaaaacct
actcttgtgacaattgcaaggtcaagtctggacgattactgtccttctgagcaagttgac
accattcaagagaaagtcctcaatgtgctacgctccctctatggagctgtagacattcac
ttggtgtatttagcagaatgttctccaccttga

DBGET integrated database retrieval system