KEGG   Canis lupus familiaris (dog): 612663
Entry
612663            CDS       T01007                                 

Gene name
VAMP7
Definition
(RefSeq) vesicle-associated membrane protein 7 isoform X2
  KO
K08515  vesicle-associated membrane protein 7
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    612663 (VAMP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    612663 (VAMP7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    612663 (VAMP7)
Membrane trafficking [BR:cfa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    612663 (VAMP7)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   612663 (VAMP7)
SSDB
Motif
Pfam: Synaptobrevin Longin PMT_4TMC
Other DBs
NCBI-GeneID: 612663
NCBI-ProteinID: XP_013967325
Ensembl: ENSCAFG00000019645
VGNC: 48226
Position
X
AA seq 220 aa
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGIDKVVETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLAR
AMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK
NT seq 663 nt   +upstreamnt  +downstreamnt
atggccattctttttgcagttgttgccaggggaacgactatccttgccaaacatgcttgg
tgtggaggaaacttcctggaggtgacagagcagattctggctaagataccttctgaaaat
aacaaactcacatactcacatggcaattatttgtttcattacatctgccaagacaggatt
gtatatctttgtatcactgatgatgattttgaacgttcccgagcatttaattttctgaat
gagattaagaagaggttccagactacatatggttcaagagcacagacagcactcccatat
gccatgaacagcgagttctcaagtgtcttggctgcacagttgaagcatcactctgagaat
aagggcatagacaaagtggtggagactcaagcccaagtggatgaactgaaaggaatcatg
gtcagaaacatagatctggtagctcagcgaggagaaagattggaattattgatagataaa
acagaaaatcttgtggattcgtctgtcaccttcaaaacaacaagtagaaatcttgcacga
gccatgtgtatgaagaatctcaaactcactatcatcatcatcatcgtatcaatcgtgttc
atctatatcattgtgtcacctctctgtggtggatttacatggccaagttgtgtgaagaaa
taa

DBGET integrated database retrieval system