KEGG   Canis lupus familiaris (dog): 612683
Entry
612683            CDS       T01007                                 

Gene name
RABGGTB
Definition
(RefSeq) geranylgeranyl transferase type-2 subunit beta isoform X3
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cfa01006]
    612683 (RABGGTB)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    612683 (RABGGTB)
Enzymes [BR:cfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     612683 (RABGGTB)
Prenyltransferases [BR:cfa01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   612683 (RABGGTB)
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    612683 (RABGGTB)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    612683 (RABGGTB)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-GeneID: 612683
NCBI-ProteinID: XP_005622111
Ensembl: ENSCAFG00000020392
VGNC: 45304
UniProt: F1P6X0
Position
6
AA seq 331 aa
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLM
GQLHRMNREEILTFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVV
EYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVSPVFCMPEEVLRRVNVQPELVS
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggcacaccgcagaaggatgttatcatcaagtcagatgcacctgacacactgctgtta
gagaagcatgcggattatatcgcgtcctatggctccaagaaagatgattatgaatactgt
atgtctgaatatttgagaatgagtgggatctattggggtctgactgtgatggatctgatg
ggacaactacatcggatgaatagagaagaaattctgaccttcattaagtcatgtcaacat
gagtgtggtggaataagtgctagtattggacatgacccccatcttttgtacactctaagt
gctgtccagattcttactctgtatgatagtattaatgttattgatgtaaataaagttgtg
gaatatgttcagagtctacagaaagaagatggttcttttgctggagatatatggggagaa
atagatacaagattctctttttgtgcggtggcaaccttggctctgttggggaagctagac
gctattaatgtggaaaaggcaattgaatttgttttatcgtgtatgaactttgatggtgga
tttggttgcaggccaggttctgaatcccatgctgggcagatctattgttgcacaggattt
ctggctattactagccagttgcatcaagtaaattctgatttactcggttggtggctttgt
gaacgacagttaccatcaggtggactcaatggaaggcccgagaagttaccagatgtctgc
tattcgtggtgggtgttggcttccctaaagataattggaaggcttcattggattgataga
gagaaactgcgaagtttcattttagcatgtcaagatgaagaaacaggaggatttgcagac
cgaccaggagacatggtagatccttttcatactttatttggaattgctggattgtcactt
ttgggagaagaacagattaaacctgttagtcctgttttttgcatgcctgaagaagtgctt
cggagagtcaatgttcagcctgaactagtgagctag

DBGET integrated database retrieval system