KEGG   Citrobacter farmeri: CI104_00120Help
Entry
CI104_00120       CDS       T05012                                 

Gene name
dsdA
Definition
(GenBank) D-serine dehydratase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00260  Glycine, serine and threonine metabolism
cfar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CI104_00120 (dsdA)
Enzymes [BR:cfar01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     CI104_00120 (dsdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF2582
Motif
Other DBs
NCBI-ProteinID: AST77599
UniProt: A0A223JK45
Position
complement(23382..24704)
Genome map
AA seq 440 aa AA seqDB search
MENIQKLIAQYPLVEELVALRETTWFNPGTTSLAEGLPYVGLTEEDVKGAHARLARFAPY
LAKAFPETAATGGIIESEVVAIPAMQQRLEKQYGQKISGEILLKKDSHLPISGSIKARGG
IYEVLTHAEKLAREAGMLTPEEDYSVLLSPKFTAFFSQYSIAVGSTGNLGLSIGIMSARI
GFNVTVHMSADARAWKKAKLRSHGVTVVEYEEDYGVAVEQGRKAAESDPNCFFIDDENSR
TLFLGYAVAGQRLKAQFEQQGRVVDADHPLFVYLPCGVGGGPGGVAFGLKLAFGDNVHCF
FAEPTHSPCMLLGVYTGLHDKIAVQEIGIDNQTAADGLAVGRASGFVGRAMERLLDGLYT
LSDRSMYDMLGWLAQEEDIRLEPSALAGMAGPQRVCASTDYQQMQGISAEQLNNATHLVW
ATGGGMVPEAEMAQYLAKGR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatacaaaaactcatcgcccagtatcctttggtggaggagctggtggctcta
cgagaaacgacctggttcaacccgggaaccacctctctggcggaaggtttaccttatgtg
gggctgacggaagaagacgttaaaggtgcccacgcccgtctggcgcgcttcgccccgtat
ctggcaaaagccttcccggaaaccgctgcgaccggagggatcattgaatctgaggtcgtc
gccattccggctatgcaacaacgtctggaaaagcagtacggacagaaaatcagcggggaa
atcctgctgaaaaaagacagtcatctgccaatatctggctcaattaaagcgcgcggcggc
atttatgaagtcctgacgcacgccgaaaaactggcgcgggaagccggtatgctgaccccc
gaagaggactacagcgttctgctttcgccaaagttcacagccttctttagccagtacagc
atcgccgtgggttcaaccggcaacctggggctgtctatcggcattatgagcgcccgcatt
ggctttaacgttacggtgcatatgtctgcggatgcccgtgcatggaagaaagccaaactg
cgtagccacggcgtcaccgttgtcgaatacgaagaagattacggcgtggcggttgagcag
ggtcgcaaagcagcggagtccgatccaaactgcttctttattgacgatgaaaactcccgc
acgctgtttttaggttatgcggttgccgggcagcgtctgaaagcgcaattcgaacagcaa
ggccgcgtggtggatgccgatcacccgctgtttgtttatctgccgtgtggcgtggggggt
ggccctggcggggtggcgtttggtctgaaactggcatttggcgataacgtgcactgcttt
ttcgctgaacccacccattccccatgcatgctgctgggcgtgtataccgggctgcacgac
aagatcgccgtgcaggaaatcggtatcgataaccagacagcggcagatggtctggcagta
ggacgtgcatccggctttgtcggcagagcgatggaacgtctgctggacgggttgtatacc
ctcagcgatcggtctatgtacgacatgctgggctggctggcacaggaggaggacattcgt
ctggaaccgtcagcactggcgggaatggccgggcctcagcgcgtctgcgcatccactgac
tatcagcagatgcagggcattagcgctgagcaacttaataatgccacgcacctggtctgg
gcgacgggtggcggcatggtgccagaagcagaaatggcgcaatacctggcgaaaggacgc
taa

DBGET integrated database retrieval system