KEGG   Citrobacter farmeri: CI104_01615Help
Entry
CI104_01615       CDS       T05012                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00071  Fatty acid degradation
cfar00072  Synthesis and degradation of ketone bodies
cfar00280  Valine, leucine and isoleucine degradation
cfar00310  Lysine degradation
cfar00362  Benzoate degradation
cfar00380  Tryptophan metabolism
cfar00620  Pyruvate metabolism
cfar00630  Glyoxylate and dicarboxylate metabolism
cfar00640  Propanoate metabolism
cfar00650  Butanoate metabolism
cfar00900  Terpenoid backbone biosynthesis
cfar01100  Metabolic pathways
cfar01110  Biosynthesis of secondary metabolites
cfar01120  Microbial metabolism in diverse environments
cfar01130  Biosynthesis of antibiotics
cfar01200  Carbon metabolism
cfar01212  Fatty acid metabolism
cfar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CI104_01615
   00630 Glyoxylate and dicarboxylate metabolism
    CI104_01615
   00640 Propanoate metabolism
    CI104_01615
   00650 Butanoate metabolism
    CI104_01615
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CI104_01615
   00072 Synthesis and degradation of ketone bodies
    CI104_01615
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CI104_01615
   00310 Lysine degradation
    CI104_01615
   00380 Tryptophan metabolism
    CI104_01615
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CI104_01615
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CI104_01615
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CI104_01615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfar04147]
    CI104_01615
Enzymes [BR:cfar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CI104_01615
Exosome [BR:cfar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CI104_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AST77869
UniProt: A0A223JKW2
Position
complement(337303..338481)
Genome map
AA seq 392 aa AA seqDB search
MSDSIVIVSAKRTPIGKFAGSLEGIPAVMLGATSVRANLLDLPSDIKIDEVILGNVLQAG
LGQNPAHQVTHHAGLAESVPSFTVNKVCGSGLKTIVLGAQSILSGDNQTCIVGGMENMSA
APYLMAHARQGYRMGNGELTDVMIHDGLWCAFNDYHMGITAENIAKRYHLSREEQDRVAL
ASQQKAITAINAGYFRQEIVPVTVKRKKEVCLFDTDEFPRPETDAGSLAKLRPAFQSTGT
VTAGNASGINDAAATLVLMSERAARARGITPLARLKSWASAGVDASMMGLGPIPATKRAL
EKAKMTVSDLDLIEANEAFAAQYLAVARELEFPEEKVNVNGGAIALGHPIGASGARILVT
LVHALQQRNKSTGLATLCIGGGQGIAVIVERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactccattgtcattgtgagtgcgaaacgcacccctatcggtaaatttgccggc
agcctggaaggcatcccggcggtgatgctgggcgcgaccagcgtgcgggcgaatctgctg
gaccttccgtcagatatcaagattgacgaggtgatcctcggcaacgtgttacaggccgga
ttagggcaaaacccagcccaccaggtgacgcatcatgcgggcttagcggagagcgttccg
tcattcacggtaaataaagtctgcggctccggcctgaaaaccatcgtgctgggcgcacag
tccattttgagtggtgataatcagacctgtattgtcggcgggatggaaaacatgagcgcc
gccccctacctgatggcccacgcgcgccaggggtatcgtatgggcaacggtgaactgacg
gatgtgatgatccacgacgggctctggtgcgccttcaatgattaccacatggggatcacg
gcagaaaacattgccaaacgctatcacttaagccgcgaggagcaggaccgggtcgcgctg
gcatcgcagcaaaaagcgataaccgcgatcaacgccggctatttcaggcaggaaatcgta
ccggtaaccgtgaagcgtaaaaaagaggtatgtctgtttgataccgatgagtttccacgc
ccggaaaccgatgccggttcgctggcgaaactacgtccggcctttcaaagcacaggaaca
gtcaccgcgggcaatgcctccggcatcaatgacgcggcggcgacgctggtcctgatgtcc
gaacgcgctgcgcgtgcgcgtgggattacaccgttagcgcgcctgaagagttgggcttcg
gccggggttgacgccagtatgatgggactcggcccaataccggcgacaaaacgggcgctg
gaaaaagccaaaatgacggttagcgatctggatttaatcgaagccaacgaagcctttgcc
gcgcagtatctggcagttgcccgcgaactcgaattccctgaagagaaagtgaacgtcaac
ggcggcgcgatcgcgctgggacatcctattggcgcaagcggcgcacgaattctggtgacg
ctggttcacgcgttgcagcagcgcaataaatccaccgggctggcaacgctgtgcatcgga
gggggtcaggggatcgccgtgattgttgagcgtctgtaa

DBGET integrated database retrieval system