KEGG   Citrobacter farmeri: CI104_01725Help
Entry
CI104_01725       CDS       T05012                                 

Definition
(GenBank) two-component system sensor histidine kinase EnvZ
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
cfar  Citrobacter farmeri
Pathway
cfar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CI104_01725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfar01001]
    CI104_01725
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cfar02022]
    CI104_01725
Enzymes [BR:cfar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CI104_01725
Protein kinases [BR:cfar01001]
 Histidine kinases
  OmpR family
   CI104_01725
Two-component system [BR:cfar02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CI104_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AST77890
UniProt: A0A223JL43
Position
364050..365402
Genome map
AA seq 450 aa AA seqDB search
MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT
EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR
IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG
VSHDLRTPLTRIRLATEMMGEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD
LNAVLGEVVAAESGYEREIDTALQPGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSS
GTEPHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRMIDNHNGML
EIGTSERGGLSIRAWLPVPVVRVQGTTKEA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaatgcgcttctcgccacgaagttcatttgcccgcacgctgctgctcatcgtc
actctgctgtttgtcagcctggtgacgacttatctggtggtgctgaactttgcgattttg
ccgagtctccagcagtttaataaggtcctggcctacgaagtgcgtatgctgatgaccgat
aaactgcaactggaggacggcacgcaactggtggtgcctcccgcttttcgccgggaaatt
taccgcgagctggggatttctctctattccaacgaagccgccgaagaggccggactgcgc
tgggcccaacactatgaattcttaagccatcagatggcgcagcagttgggcggcccgacg
gaggtgcgtgttgaggtcaacaaaagctcgccagtcgtctggctgaaaacctggctgtcg
cccaatatctgggtacgcgtgccgttaacggaaattcatcagggcgacttctccccgctg
ttccgctatacgctggccatcatgcttctggcgatagggggagcgtggctgtttatccgt
atacaaaatcgccccctggtggatctcgagcatgccgcgttgcaggttgggaaaggcatt
attccaccgccgctgcgtgagtacggcgcgtctgaggtacgctcagtgacccgtgccttc
aaccatatggcggccggggtgaagcagttagcggatgaccgaacgctgctgatggcgggg
gtcagtcacgatcttcgcacgccgctgacgcgtattcgtctcgcgacggaaatgatgggt
gagcaggatggctatctggcggagtccatcaacaaagatatcgaagagtgcaacgcgatc
attgagcagttcatcgactatctgcgtaccggacaggaaatgccgatggagatggccgat
cttaacgccgtgctgggcgaggtggtggcagcagaaagcggctatgagcgtgaaattgat
acggcgctacagccgggcagcattcaggtgaaaatgcatccgctgtctattaagcgtgcg
gtggccaacatggtggttaacgctgcgcgctatggcaacggatggatcaaagtcagcagc
gggacagaacctcatcgagcctggttccaggtggaggatgacggccccggcattaaacct
gaacagcgcaaacacctgttccagccgtttgtgcgtggcgacagtgcgcgcagcaccagc
ggtaccgggttagggctggcaattgtgcagcgtatgatcgataaccataacggtatgctg
gaaattgggaccagtgagcggggcgggctctccatccgcgcctggctaccggttcctgtg
gtccgtgtccaggggacgacaaaagaggcataa

DBGET integrated database retrieval system