KEGG   Citrobacter farmeri: CI104_13290Help
Entry
CI104_13290       CDS       T05012                                 

Definition
(GenBank) L-talarate/galactarate dehydratase
  KO
K20023  L-talarate/galactarate dehydratase [EC:4.2.1.156 4.2.1.42]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00053  Ascorbate and aldarate metabolism
cfar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CI104_13290
Enzymes [BR:cfar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     CI104_13290
    4.2.1.156  L-talarate dehydratase
     CI104_13290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AST79977
UniProt: A0A223JRX1
Position
2662047..2663243
Genome map
AA seq 398 aa AA seqDB search
MSLSANSDAVTYAKAANARTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEV
AIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGA
SVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVL
KNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDDFPLMVDANQQWDRETAIRMG
RKMEQFNLIWIEEPLDAYDVEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQP
DAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQ
LELRDGRMWISDRHGLGFTLSEQARRWTQLSCEFGKRP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaagcgcgaattctgacgccgtaacctatgccaaagcagccaatgccagaacg
gcggcggaaaccggcgatcgtatcgagtgggtgaagctgtcactggcatttctgccgctg
gcaactccggtaagtgacgccaaagtgttgaccggtcgccagaaaccgctgaccgaggtg
gcaatcattatcgcggagatccgcagtcgcgatggattcgaaggtgtcggtttcagctat
tcaaaacgagccggcggccaggggatttacgctcatgccaaagagatcgccgacaacctg
ctgggtgaagatccgaatgatatcgacaagatctacaccaagctgctgtgggctggcgcc
tccgttggccgcagcggaatggcggtacaggccatctcccctatcgatatcgccctctgg
gacatgaaagccaaacgtgctggcctgccgctggcaaaactgctgggcgcgcaccgggat
tctgtgcagtgctacaacacctccggtggtttcctgcatactccgctcgatcaggtgctg
aaaaatgtcgtgatttcacgcgaaaatggcatcggcgggatcaagctgaaagtcggtcaa
cccaactgcgccgaggacatccgccgcttaaccgccgtccgcgaagcgctgggtgatgac
ttcccgttaatggtggatgccaaccaacagtgggatcgcgaaacggcaatccgcatgggg
cgcaaaatggagcagttcaatctcatctggattgaagagccgctggatgcctacgatgtt
gaaggtcacgcccagctagccgcggcgctggatacgcctatcgcgaccggtgaaatgctc
accagcttccgcgagcatgaacagctgattctggggaacgccagcgacttcgtccagcct
gatgctccgcgcgttggcggcatttcaccgttcctgaagattatggatctggccgcaaaa
cacgggcgtaaacttgcgccacactttgccatggaagttcacctccatctgtccgccgcc
tatccgctggagccgtggctggagcatttcgagtggctgaacccgctgttcaacgaacag
cttgaactgcgcgacggtcgcatgtggatctccgatcgtcacggtctgggctttactctg
agcgagcaggcacgccgctggactcaactaagctgcgaatttggcaaacgcccctga

DBGET integrated database retrieval system