KEGG   Citrobacter farmeri: CI104_13580Help
Entry
CI104_13580       CDS       T05012                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00010  Glycolysis / Gluconeogenesis
cfar00071  Fatty acid degradation
cfar00350  Tyrosine metabolism
cfar00625  Chloroalkane and chloroalkene degradation
cfar00626  Naphthalene degradation
cfar00680  Methane metabolism
cfar01100  Metabolic pathways
cfar01110  Biosynthesis of secondary metabolites
cfar01120  Microbial metabolism in diverse environments
cfar01130  Biosynthesis of antibiotics
cfar01200  Carbon metabolism
cfar01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CI104_13580
  09102 Energy metabolism
   00680 Methane metabolism
    CI104_13580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CI104_13580
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CI104_13580
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CI104_13580
   00626 Naphthalene degradation
    CI104_13580
Enzymes [BR:cfar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CI104_13580
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CI104_13580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 TrkA_N Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AST80032
UniProt: A0A223JS98
Position
complement(2722772..2723890)
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFGPGQPLKIVEIDVALPKKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGVVVEVGEGVTSLKPGDHVIPLYTAECGECKFCKSGKTNLCQAVRATQGKGVMPD
GTTRFSYNGEPIYHYMGTSTFSEYTVCAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRIIAVDTNPEKFKLAAEMGATDFINPKD
YDKPIQEVIVELTDGGVDFSFECIGNVNVMRAALECCHKGWGESIIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMAGRIQLDPFITHRLPLDQINDAFDLMHEG
KSIRTVIHFGDN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagcagtcgcgtttggccctggtcagccgcttaaaattgttgaaatt
gacgtcgcactgccgaaaaaaggcgaagttctggtcaaaatcacccatactggtgtatgt
cacactgacgcgtttacgctttctggcgacgatccggaaggggtattcccggcggttctg
ggacatgaaggtggtggcgtggtggtcgaggtcggtgaaggcgttaccagcctgaaaccg
ggcgatcatgtcatcccgttgtataccgccgaatgcggcgagtgcaaattctgtaaatcc
ggcaagaccaacctctgtcaggccgtgcgtgccacccaggggaaaggcgtaatgccggat
gggactacccgtttttcctataacggcgaacccatctatcactacatggggaccagtacc
ttcagtgaatacaccgtgtgtgcggaaatctcgctggcgaaggtcaatccgcaagcgcct
ctggacaaggtctgtctgcttggttgcggagtgaccacgggcattggtgctgtgcataac
accgcaaaagtcaaagagggcgataccgttgctgtgtttggcctcggcggaattggcctg
gcggtgatccagggggcagtgcaggcgaaagccggacgtattattgctgtcgataccaac
ccggaaaaattcaaactggcggctgaaatgggcgcaaccgacttcatcaacccgaaggac
tatgacaaaccgatccaggaggtgattgttgagctcaccgacggtggcgtggactttagc
ttcgaatgtattggtaatgtaaacgtgatgcgcgcggcgctggaatgttgccataaaggg
tggggcgaaagcatcatcattggcgttgccggggcgggccaggagatcaaaacccgtcca
ttccagttggtgacggggcgtgtctggcgcggctccgcatttggcggcgttaaagggcgt
acccagttgccggggatggtggaagacgcgatggccgggagaatccagttggatccgttc
attacccaccgcctgccgctggatcaaatcaacgacgcgtttgacctgatgcacgaaggt
aaatccatccgtaccgttatccatttcggcgataactga

DBGET integrated database retrieval system