KEGG   Citrobacter farmeri: CI104_16170Help
Entry
CI104_16170       CDS       T05012                                 

Definition
(GenBank) cobyrinate a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00860  Porphyrin and chlorophyll metabolism
cfar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CI104_16170
Enzymes [BR:cfar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     CI104_16170
    6.3.5.11  cobyrinate a,c-diamide synthase
     CI104_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DUF1611 MobB CTP_synth_N
Motif
Other DBs
NCBI-ProteinID: AST80499
UniProt: A0A223JTC4
Position
complement(3228817..3230196)
Genome map
AA seq 459 aa AA seqDB search
MAAKQYAFVLAGTGSGCGKTTVTLGLLNVLKQRGLRVQPCKVGPDYLDTAWHTAISGAAS
RNLDSFMLPESILNALFREQMQDADIAVIEGVMGLYDGYGTDPDYCSTAAMAKQLGCPVI
LLVDGKAVSTSIAATVMGFQHFDPTLNIAGVIVNRVNSESHFQLLKTAIEHYCAVPVLGY
VPRVDGVALPERHLGLVTARESVVNQQSWQDFSARLENTLNIDQLLALSHLAALPQGDWP
EVPAANAGEGLTLAMADDEAFNFYYPDNVKLLARTGVNIVRFSPIHDRALPDCQMVWLGG
GYPELHAAALAANTTMLASLREAHHRGVAIYAECGGLMYLGSVLEEADGVEHRMAGIIPG
RSKMGKRLTRFGYCEAQALQPTLLAAEGDVLRGHEFHYSDFSPETPAVLACRKVRDGQTV
QAWSGGWRIGNTFASYLHVHFAQRPLMLNHWLNAAREAL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaagcagtacgcgtttgttctggcaggtaccggtagtggctgtggtaaaacc
acggtgaccctgggcttgctgaacgtattgaaacaacgtggtttacgcgttcagccctgc
aaagtcggccctgactatctggataccgcctggcatacggccatcagcggcgccgcttcc
cgtaatctcgacagctttatgcttcccgaatcgatccttaatgccctgttccgcgagcag
atgcaggacgcagatattgcggtgattgaaggggtgatggggctgtatgacggctatggc
actgaccctgactactgcagtaccgccgcgatggcaaaacagttaggctgtccggtgatc
ctgctggttgacgggaaagccgtttcaacctccattgccgctacggtgatgggcttccag
cattttgacccgacgctgaacattgccggcgttatcgttaatcgcgttaacagcgagtcc
cattttcagttgctgaaaactgccattgagcactactgcgcggtgccagtgctgggttac
gtcccgcgtgttgatggcgtcgcgctacctgaaaggcacctggggctggtgaccgcgcgc
gaatcagttgtaaatcaacagtcgtggcaggatttctccgcccgactggaaaacacgctg
aatatcgaccagttactggcgttaagccatcttgcggcgttaccgcagggtgactggcca
gaggttcctgcggcgaacgccggggaggggctgacgctggcgatggccgatgacgaagcc
tttaacttttattatcccgataacgtgaagcttctggcgcgtactggtgtcaacattgtg
cgctttagtccgatccacgatcgcgcgttgcctgattgccagatggtctggttgggcggc
ggttatccggaactgcatgcggctgcgctggcggctaataccacgatgctggcaagcctg
cgcgaggcgcatcatcgcggcgtcgcgatctacgccgagtgcggcggattgatgtacctc
ggcagcgtgctggaagaggctgacggggttgagcatcgcatggccggtatcatcccaggc
cgtagcaaaatgggtaaacgactgacccgcttcggctattgcgaagcgcaagctctacag
cccacgctgttggccgcagaaggtgatgtgctgcgtggccatgaatttcattactccgat
ttttctcccgaaacgcctgctgtgttggcatgtcgcaaagtccgtgacggtcagacggtg
caagcgtggtccggcggctggcgaatcggcaatacctttgccagctatctgcacgttcac
tttgctcagcgtccattaatgctaaatcactggctgaacgccgcaagggaggcgttatga

DBGET integrated database retrieval system