KEGG   Citrobacter farmeri: CI104_17670Help
Entry
CI104_17670       CDS       T05012                                 

Definition
(GenBank) histidine ABC transporter ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
cfar  Citrobacter farmeri
Pathway
cfar02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CI104_17670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfar02000]
    CI104_17670
Enzymes [BR:cfar01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     CI104_17670
Transporters [BR:cfar02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    CI104_17670
   Histidine transporter
    CI104_17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 AAA_16 ABC_ATPase AAA_23 PRK G-alpha AAA_24 AAA_33 RsgA_GTPase FtsK_SpoIIIE NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: AST80782
UniProt: A0A223JUE8
Position
complement(3550215..3550988)
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SIVVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAIKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQLF
GNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaataaattaaacgttatcgatttgcacaaacgctacggcgaacacgaagtg
ctgaaaggggtttcgctgcaggccaacgccggggatgtgatcagtattattggctcatcc
ggatcggggaaaagcacgttcttgcgctgcataaacttcctcgaaaaaccgagcgaaggg
tcgattgtggtcaatggccagaacatcaacctggtgcgtgacaaagatggtcagctaaag
gtggcggataaaaatcagcttcgtttactgcgtacgcgtctgacgatggtgtttcagcat
tttaacctgtggagccacatgacggtgctggaaaacgtgatggaagcgccgattcaggta
ctgggtctgagcaaacaggaggcccgcgaacgggcgatcaaatacctggcaaaagtcggc
attgatgaacgtgcccaggggaaatatccggtgcatctttctggtggtcagcagcagcgg
gtgtcgattgcgcgcgcgttggcaatggaaccagaagtgttgctctttgatgaaccgact
tcggcgctggatcctgaactggtgggtgaggtgctgcgtatcatgcagcaactggcggaa
gagggaaaaacgatggtggtggtgacgcatgaaatgggctttgctcgccatgtttccagc
cacgttatttttctgcatcaggggaaaatcgaagaagagggggatccggagcaactcttt
ggcaatccgcaaagtccacgcctgcaacagttcctgaaaggatcgctaaagtga

DBGET integrated database retrieval system