KEGG   Citrobacter farmeri: CI104_20885
Entry
CI104_20885       CDS       T05012                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00230  Purine metabolism
cfar01100  Metabolic pathways
cfar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CI104_20885
Enzymes [BR:cfar01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CI104_20885
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AST81368
UniProt: A0A223JW33
Position
4200646..4202943
AA seq 765 aa
MDAREATATGESCMRVDAIAKVTGRARYTDDYMMAGMCYAKYVRSPIAHGYATSINCDEA
KSLPGVLAVFTWEDVPAIPFATAGHAWTLDENKRDTADRLLLTRHVRHHGDAVAIVVARD
ELTAENAALLVKVEWEKLPVITTPEAALAHDAALIHPGGNLLNRSEMTTGDVQQAIDAAD
YQHHGYYQTPVIQHCHMESVTSFAWMEDDSRISIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPYVGGGFGNKQDVLEEPMAAFLTRKLGGIPVKVSLSREECFLASRTRHAFTIDGQMG
LNRDGTLKGYRLDVLSNTGAYASHGHSIASAGGNKVAWLYPRSAYAYRSTTCYTNLPSAG
AMRGYGAPQVIFAVESMLDDAATALGLDPLEVRLRNAACEGDKNPITGKRIYSAGLPECL
QKGRTLFEWDARRAECQRQQGNIRRGIGVACFSYTSNTWPVGVEIAGARLLLNQDGTINV
QSGATEIGQGADTVFSQMVAETLGVPVSDVHVISTQDTDITPFDPGAFASRQSYVAAPAL
RKAAIQLRDKILHHAADMLHQSVMNLTLTAGSIVLIDRPDSPLLSLKDLAMDAFYHPERG
GQLSAECSVKTTTNPPAFGCTFVDLSVDIALCKVTINRILNVHDSGHILNPQLAEGQVHG
GMGMGIGWALFEEMIIDEESGLVRNPNLLDYKMPTMPDLPQLESAFVETREPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAIDTLPLTPKRLYAEFHQAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatgcgcgggaagcaaccgctaccggtgagtcatgtatgcgcgtggatgccattgct
aaagtgaccgggcgggctcgatatactgatgattacatgatggcgggcatgtgttatgcc
aaatacgtccgcagcccgattgctcacggttacgctaccagcatcaactgtgacgaggcg
aaaagccttcccggggtgttggcggtatttacctgggaagatgtacctgctattccattc
gccacggcaggacacgcctggacgctggatgagaacaaacgtgacaccgccgatcgttta
ctgttgacccgtcacgtacgccatcatggtgatgcggtcgcgattgtcgtggcaagagat
gagttaaccgcggagaatgcggccctgctggtgaaggtggaatgggaaaaactcccggtg
attaccacgccagaagccgctctggcgcatgacgcggccctcattcaccctggcggtaat
ctgctcaatcgcagtgaaatgaccacgggagatgtgcaacaggccattgatgccgcagat
tatcaacaccatggctattaccagacgccggtaattcaacattgccatatggaaagcgtc
acctcatttgcctggatggaagatgactcacgtatttccatcgtctccagcacgcagatt
ccacacatcgtgcggcgggttgtgggtcaggcgctggacattccctggtcatgcgtacgg
gttatcaaaccgtacgttggcggcggatttggcaacaaacaggacgtgctggaagagcca
atggccgccttcctgactcgtaaactgggcggcataccggtgaaagtgtcgctgagtcgc
gaagagtgttttctcgcttcccggacccgccatgcgttcaccattgatggacagatgggg
cttaatcgcgatggcacgttgaaaggctatcgtctggatgtcctgtcaaataccggcgct
tacgcctcacatggacactcgatcgcctcagcgggcggcaacaaagtggcctggctctat
ccccgaagcgcgtatgcttaccgttccaccacctgctacaccaatctcccttctgctggc
gcgatgcgcggttacggcgcgccgcaggtgatctttgccgtggaatcgatgctggatgat
gccgcgacggcgctgggtctcgatccgctcgaggttcggttacgaaatgcggcttgtgaa
ggtgacaaaaacccgattaccggcaaacgcatctacagcgcgggactcccggaatgtctg
caaaaaggccgcacgctgtttgaatgggacgcccgtcgtgcagaatgtcaacgtcagcag
ggcaacatccgccggggcatcggcgtcgcctgctttagctacacctccaacacctggccg
gtcggcgtggagatcgccggagcccgcctgcttttgaaccaggatggcacgatcaacgtt
cagagcggtgccacggaaatcggtcagggggcggataccgtcttctcacagatggtggcg
gagaccctcggcgtaccggtcagcgatgtgcacgtcatttcgacccaggataccgatatc
accccattcgaccctggcgcattcgcctctcgccaaagctatgtcgccgcaccggcactg
cgcaaagcagcaatacaactgcgcgataagatcctccatcacgctgccgacatgctgcat
cagtccgtcatgaatctgacgctgacggcaggtagcatcgtccttatcgatcgcccggac
tctccgttactgtcattaaaagacctggcgatggatgcgttttatcacccggaacgcggc
ggtcagctgtcagcggaatgctccgtgaaaacaaccaccaacccaccggcgtttggctgc
acgtttgtcgatctgagcgtcgatatcgcactgtgcaaggtcacgatcaaccgcatcctc
aatgtccatgattctggccatatcctgaacccgcaactcgcggaaggacaggtgcacggc
ggaatggggatgggcattggctgggcgctgtttgaagagatgatcatcgatgaggaaagt
ggcctggtacgaaaccctaatctcctcgattacaaaatgccaactatgcccgacctgccg
caactggaaagcgccttcgttgaaacccgggagccgcaatcggcatatgggcataaatct
ctcggcgaaccgcccattatcccggttgctgccgccattcgtaacgcagtgaaaatggcc
acaggcgttgctattgatacgctgcccctgacgccaaaacggctgtatgcggagttccac
caggctggcttgatttga

DBGET integrated database retrieval system