KEGG   Citrobacter farmeri: CI104_20895
Entry
CI104_20895       CDS       T05012                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cfar  Citrobacter farmeri
Pathway
cfar00230  Purine metabolism
cfar01100  Metabolic pathways
cfar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CI104_20895
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AST81370
UniProt: A0A223JVU3
Position
4203829..4204308
AA seq 159 aa
MNDTNRITLECVINGHPFQLSIMPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAAGKQIRTLEGESAGGQLSRVQMAYASSGAVQCGFCTPGLIMATTAMLAK
PREQPLTILEIRRGLAGNLCRCTGYQMIVDTVQRCTEPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatgacactaaccgaatcacgctggaatgcgttatcaatggtcacccttttcagctc
agtatcatgccgggaatgccgctctctgaactcctgcgcgaacaagggttgctgagcgtt
aaacagggatgctgtgtcggtgaatgcggagcctgtacggttctggttgatggtacagcc
attgacagttgcctgtatcttgccgcgtgggcagcaggaaaacagatccgcacactggaa
ggcgaatcggctggcggccaactctcacgagtccagatggcttatgcctcatccggcgcc
gtgcagtgcggcttttgcacgccgggtttaatcatggcgaccaccgctatgctggcaaag
ccacgggaacagccgttaaccattctggagatccgtcgcgggctggcgggaaatctgtgt
cgttgcaccggttatcaaatgattgtcgataccgtacaacgctgcaccgagccggagtaa

DBGET integrated database retrieval system