KEGG   Corynebacterium flavescens: CFLV_00165Help
Entry
CFLV_00165        CDS       T05018                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cfc  Corynebacterium flavescens
Pathway
cfc00670  One carbon pool by folate
cfc01100  Metabolic pathways
cfc01120  Microbial metabolism in diverse environments
cfc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CFLV_00165
Enzymes [BR:cfc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CFLV_00165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: APT85781
UniProt: A0A1L7CIV0
Position
32684..33625
Genome map
AA seq 313 aa AA seqDB search
MSPRLSASVPLDHLNESEEFSSSASQPHSRVALSFEVIPPRHDADETKVTQLLRVLEAYN
PDYIAVTSSQRSGWLEGTAAFIARVAQETTMRPLAHLACTAGTAQELDGWIDKLVDSGVR
GLLALRGDVPPGGMPPGHLHHADELVRLIRRKEAEQAARFAAGRLAVGVACYPNGHAESA
SADEDFDVLLAKQRCGADLAISQLFFDAEDFLRFSQKARLAGVRIPLIPGIMPMTSMRRL
ERMGQLSGLKVPPRVSARLAAATSPEEEHEIGMELTAELARSVIDAGITGLHIYTHNNAE
VTQDLLERIGVTS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgagattatccgcatctgtgccactagaccatttaaatgaatccgaggagttt
tcctcctctgcatcacagccacacagccgggtagcgctgtcctttgaggtgattccaccg
cgtcatgacgccgacgagaccaaggtaacccaattgttgcgggtcctcgaggcctataac
ccggactatatcgcggtaaccagctcccagagatcgggctggctggaggggaccgccgcc
tttatcgcccgggtggcgcaggaaaccacgatgcgtccactcgcgcacctggcatgtacc
gcaggcacagctcaggaactcgatggctggatagacaagctcgtcgattccggggtgcgc
ggcctcttagccctgcgtggggacgtgccgccagggggcatgcccccaggtcacctccat
cacgccgatgagttggtgcgccttatccgccgcaaggaagcggagcaggccgcacgcttt
gcggccggacgcctcgcagtgggcgtcgcctgttatcccaatggccacgccgagtcagcc
agtgcggacgaggacttcgacgtcctcctggccaagcaacgctgcggcgcggatctggcc
atcagccagctcttcttcgatgccgaggacttcctgcgctttagccaaaaggcacggctg
gccggggtgcgtatcccgctcattccgggaatcatgccgatgacaagcatgcggaggctg
gagcgaatgggccagctgtccgggctgaaggtacctccccgggtatccgcaaggctcgcg
gcagcgacaagccccgaagaagaacacgaaatcggcatggagctcaccgctgagctcgcc
cgctccgtcatcgacgccggaatcaccggacttcatatctacacccacaacaacgccgag
gtcacccaagacctcttagaaagaatcggagttacatcatga

DBGET integrated database retrieval system