KEGG   Corynebacterium flavescens: CFLV_03120Help
Entry
CFLV_03120        CDS       T05018                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfc  Corynebacterium flavescens
Pathway
cfc00071  Fatty acid degradation
cfc00280  Valine, leucine and isoleucine degradation
cfc00310  Lysine degradation
cfc00362  Benzoate degradation
cfc00380  Tryptophan metabolism
cfc00620  Pyruvate metabolism
cfc00630  Glyoxylate and dicarboxylate metabolism
cfc00640  Propanoate metabolism
cfc00650  Butanoate metabolism
cfc00900  Terpenoid backbone biosynthesis
cfc01100  Metabolic pathways
cfc01110  Biosynthesis of secondary metabolites
cfc01120  Microbial metabolism in diverse environments
cfc01130  Biosynthesis of antibiotics
cfc01200  Carbon metabolism
cfc01212  Fatty acid metabolism
cfc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFLV_03120
   00630 Glyoxylate and dicarboxylate metabolism
    CFLV_03120
   00640 Propanoate metabolism
    CFLV_03120
   00650 Butanoate metabolism
    CFLV_03120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFLV_03120
   00072 Synthesis and degradation of ketone bodies
    CFLV_03120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFLV_03120
   00310 Lysine degradation
    CFLV_03120
   00380 Tryptophan metabolism
    CFLV_03120
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFLV_03120
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFLV_03120
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFLV_03120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfc04147]
    CFLV_03120
Enzymes [BR:cfc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFLV_03120
Exosome [BR:cfc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFLV_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APT86281
UniProt: A0A1L7CK87
Position
complement(655989..657146)
Genome map
AA seq 385 aa AA seqDB search
MQDIHFVGAARLPIGKFGGSLSRMSLQEMGIAAAAEAISRSHLEPAEIETAVIANVLPTT
PQDLYISRTIALGAGLPDSSTALGVNRLCGSGLQAIVSAAQSLNFGDGTLALAGGVESMS
NAPFSIASMRQGKRLGDGVAYDWLTGALTCPFGTGHMGVTAENVAADSAISRREQDEFAA
QSQQRAKKAQESGAETEEILSVAELHHDEAVRETDLAKLASLRPAFTTEGTVTAGNSSGL
NDGAAAVVLATDTEVYERGLESLGRLVSWGIGGVDPSRMGLGPLAAVPKALNKAGLSLDD
IGLIESNEAFAAQAIAVSRGLNFDPDKTNIYGGAIAHGHPIGATGAILAVRMLYALRRHG
LRYGLITMCIGGGQGIAVIIENEEA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacattcacttcgtaggagcggcgcggctgcccattggaaaattcggcggttcg
ctttctcgcatgagcctgcaggagatgggaatcgccgccgcagccgaggccatctctcgc
tcacatctggagcccgccgagattgaaactgccgtcattgccaacgtcctgcccacaacg
ccccaagatctctacatttcccgcactatcgcgctcggcgctggcctgcccgatagctcc
actgcgttgggagtcaaccgcctgtgcggttccggcctgcaagcaatcgtctccgccgcg
caatccttaaacttcggcgacggcacactcgcgctagcaggcggcgtggagtcaatgtct
aacgcacccttttccatcgccagcatgcgccaaggaaaacgcctgggtgacggggtggcc
tatgactggctcaccggcgcgttgacgtgccccttcggcactgggcacatgggggtaact
gcagagaacgtcgctgccgacagcgccattagccggcgcgagcaagacgagttcgccgcg
cagtcccagcagcgggccaaaaaggcccaagagtcaggagccgagacagaagaaattctc
agcgtggcagaactgcaccacgacgaggcggtgcgggagacagaccttgccaagctcgcc
agcctgcgcccagccttcaccactgagggcaccgtcaccgccggcaactcctccggactc
aatgacggcgccgccgcggtggtgctcgccaccgacacggaggtctacgaacgtggcttg
gaatccctgggcaggctcgtcagctggggaattggcggagttgatccctcccgcatgggc
ctcggacccctagccgcggtgcccaaggcgctaaataaggccggattgagcctcgatgat
atcggcctcatcgaatccaacgaggccttcgcagcccaggccattgcggtctcgcgcggc
ctgaacttcgatccggacaagaccaatatctacggcggcgccatcgcgcacggccacccc
atcggggccaccggcgccatcttggcggtgcgcatgctctacgcgctgcgccgccacggc
ctgcgctacgggctcatcaccatgtgcatcggcggcggccaaggcatcgccgtcatcatc
gaaaacgaggaggcatag

DBGET integrated database retrieval system