KEGG   Citrobacter freundii: CFNIH1_04485Help
Entry
CFNIH1_04485      CDS       T03077                                 

Definition
(GenBank) malonate decarboxylase subunit alpha
  KO
K13929  malonate decarboxylase alpha subunit [EC:2.3.1.187]
Organism
cfd  Citrobacter freundii
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfd02000]
    CFNIH1_04485
Enzymes [BR:cfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.187  acetyl-S-ACP:malonate ACP transferase
     CFNIH1_04485
Transporters [BR:cfd02000]
 Other transporters
  Primary active transporters [TC:3]
   CFNIH1_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mal_decarbox_Al CoA_trans
Motif
Other DBs
NCBI-ProteinID: AHY10797
Position
complement(901960..903615)
Genome map
AA seq 551 aa AA seqDB search
MLSGQTPARVWNTRRTEKQRRLASVPVQGKVLPTADLTAMLEKLIAPGDRVVLEGNNQKQ
ADFLSRMLAEVNPQIVHDLHMIMPSVGRSEHLDIFEKGIARKLDFSFSGTQSLRISQLLE
DGQLEIGAIHTYIELYSRLYVDLAPNVALIAGYKADRKGNLYTGPSTEDTPALVEAAAFH
DGIVIAQVNELVDDECDLPRVDIPGSWIDYVVVADKPFFIEPLFTRDPRLIKQEHILMAM
MAIKGIYAEHQVQSLNHGIGFNTAAIELLLPTYGEQLGLKGKICKHWTLNPHPTLIPAIE
SGWVESVHCFGGELGMEEYIRARPDIFFTGSDGSMRSNRAFCQLAGQYAVDMFIGSTLQV
DGYANSSTVTRGRLSGFGGAPNMGHDPHGRRHATPAWLNMITEPDPMQRGKKLVVQMVET
FQAGVKPTFVEKLDAVDVAKASGMPLAPVMIYGDDVTHVLTEEGIAYLYRAKDLEERRAM
VAAVAGITDIGLGVDAKRVAELRQSGKVVYPEDMGIRRTDATRSLLAAGSVADLVEWSGG
LYNPPAKFRSW
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgggcaaacgccagcacgagtctggaacacccgccgcacggaaaaacagcgc
cgtctggcttccgttccggtgcagggtaaggtgctgccgaccgcagacctgaccgcgatg
ctggaaaaactgatcgcgccgggtgaccgcgtggtattagaagggaataaccagaagcag
gcagatttcctgtcccgcatgctggctgaagtcaatccgcagattgtgcacgacctgcat
atgattatgccaagcgtcgggcgtagcgagcatctggatatctttgaaaaaggcatcgcc
cgcaagctggacttctccttctccggtacccaaagcctgcgtatttcgcagctactggaa
gatggccaactggaaatcggcgccatccacacctacatcgaactctattcccgtctttat
gttgacctggccccgaacgtggcgctgattgccggttataaagctgaccgtaaaggtaac
ctctacaccgggccgagtaccgaagataccccggcgctggtggaagccgccgcgttccac
gacggtatcgtcatcgcacaggtgaacgagctggtggacgacgaatgcgacctgccgcgc
gtggatattccgggttcctggattgactacgtggttgtcgccgacaaaccgttctttatc
gaaccgctgtttacccgcgacccgcgcctgatcaaacaggaacacatcctgatggcgatg
atggcgattaaaggcatctacgcggaacatcaggtacagtcgctgaaccacggtatcggc
ttcaacaccgcggcgattgaactgttgctgccaacctacggtgaacagctcggtctgaaa
ggcaaaatctgtaaacactggacgctgaacccgcatccaacgctgattccggcaattgag
agcggctgggtagaaagcgtgcactgcttcggcggcgagttggggatggaagagtatatc
cgcgcccgcccagacatcttctttaccggttccgacggctcgatgcgttctaaccgcgcc
ttctgccagttggctggccagtacgcggtagatatgtttattggctccaccctgcaggtt
gatggctacgccaactcctccaccgtgacccgcggccgtctttctggcttcggcggcgcg
ccaaacatgggtcacgacccgcacggtcgtcgtcatgcaacgccagcctggctgaatatg
atcaccgaacccgacccaatgcagcgcggtaaaaaactggtggtgcaaatggtcgaaacc
ttccaggcgggcgtgaagccaaccttcgtcgaaaaactggacgcggttgacgtggcgaaa
gcctccggtatgccgctggcaccggtaatgatctacggcgatgacgtaacccacgtgctg
accgaagaaggtatcgcctacctctaccgcgccaaagatcttgaagagcgccgtgcgatg
gtggctgcggtagcagggatcaccgatatcgggctgggcgttgacgctaagcgcgttgcc
gagctgcgtcagagcggcaaggtggtctatccggaagatatgggcattcgtcgtaccgat
gccacccgttcgctgctggcagccggtagcgtcgcggacctggtggaatggtccggcggt
ctttacaacccacctgcgaaattccggagctggtaa

DBGET integrated database retrieval system