KEGG   Citrobacter freundii: CFNIH1_05395Help
Entry
CFNIH1_05395      CDS       T03077                                 

Definition
(GenBank) bifunctional glyoxylate/hydroxypyruvate reductase B
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
cfd  Citrobacter freundii
Pathway
cfd00030  Pentose phosphate pathway
cfd00260  Glycine, serine and threonine metabolism
cfd00620  Pyruvate metabolism
cfd00630  Glyoxylate and dicarboxylate metabolism
cfd01100  Metabolic pathways
cfd01110  Biosynthesis of secondary metabolites
cfd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFNIH1_05395
   00620 Pyruvate metabolism
    CFNIH1_05395
   00630 Glyoxylate and dicarboxylate metabolism
    CFNIH1_05395
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFNIH1_05395
Enzymes [BR:cfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     CFNIH1_05395
    1.1.1.81  hydroxypyruvate reductase
     CFNIH1_05395
    1.1.1.215  gluconate 2-dehydrogenase
     CFNIH1_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AHY10968
Position
1106825..1107799
Genome map
AA seq 324 aa AA seqDB search
MKPSIILYKALPDDLLHRLEEHFTVTSVPNLRPETVAQHAEAFANAEGLLGSSEAVNTAL
LEKMPRLRATSTISVGYDNFDVDALNARKVLLMHTPTVLTETVADTVMALMLSTARRVVE
VAERVKSGEWTKSIGPDWFGTDVHHKTLGIVGMGRIGLALAQRAHFGFSMPILYNARRHH
HEAEERFNARYCDLDTLLQESDFVCLILPLTNETHHLFSSEQFAKMKSSAIFINAGRGPV
VDEKALISALQNGDIHAAGLDVFEQEPVATDSPLLSLPNVVAVPHIGSATHETRYNMAAC
AVDNLIDALQGRVEKNCVNPQVAQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccattattctctataaagcgttacctgacgatttactgcatcgcctggaa
gagcattttactgtgacttctgtaccgaacctgcgcccggaaacggtcgcacagcacgcc
gaagcctttgccaacgccgaaggcctgctgggctccagtgaagccgtcaataccgcgctg
ttggagaaaatgcccaggctgcgagcgacatccacaatttccgtaggctatgacaacttc
gatgtcgatgcccttaatgcgcgtaaggtgctgttgatgcatacgccaaccgtactaacg
gaaaccgtcgccgacacggtgatggcgctgatgttaagcaccgctcgccgtgtggtggaa
gttgctgaacgggttaagtctggcgaatggaccaaaagtatcggaccggactggtttggt
acggatgtccaccacaaaacgctgggcattgtcggcatgggtcgtattgggctcgcgctg
gcgcagcgtgcgcatttcggctttagcatgccgattctctataacgcccgccgtcatcat
cacgaagcggaagaacgcttcaacgcgcgttactgcgatctcgacacactgttgcaggag
tctgattttgtctgcctgatcctgccattaaccaacgaaacacatcatctgttcagtagc
gagcagtttgccaaaatgaagtcttccgccattttcattaatgccggacgtggcccggtg
gtcgatgaaaaagcgttgattagcgctctgcaaaacggcgacattcatgccgcaggtctg
gatgtatttgagcaggagccagtagcgacagactctcctctgctgtcactgcccaacgtg
gtggctgtgccgcacattggttcagccacgcacgaaacgcgctataacatggcggcctgc
gcggtggataacttaatcgatgcgctgcaaggaagagtggagaagaactgcgtaaacccg
caggtcgcgcaataa

DBGET integrated database retrieval system