KEGG   Citrobacter freundii: CFNIH1_08090Help
Entry
CFNIH1_08090      CDS       T03077                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
cfd  Citrobacter freundii
Pathway
cfd00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFNIH1_08090
Enzymes [BR:cfd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     CFNIH1_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer AraC_binding Cupin_2 Cupin_1
Motif
Other DBs
NCBI-ProteinID: AHY11470
Position
complement(1672351..1673034)
Genome map
AA seq 227 aa AA seqDB search
MKRSAINEILGHTRQFFSLHDVHLPPFASFPPTQWRKLDASAWSEVFDLKLGWDVTAFGG
NNFAAQGLTLFTLRNGSPKGMPYEKCYAEKIMHVREAQVTPMHFHWRKREDIINRGGGNL
IVELWNAGLREQTEDSDVNVVIDGCRQTHAAGSQLRLTPGESICLPPGLYHSFWAEKGFG
DVLVGEVSSVNDDDHDNHFLHPITRYNDIEEDEPAQLVLCNEYRLFR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctccgcaataaacgaaatccttggccacacgcgccagtttttttctctgcac
gacgtgcacctcccccctttcgccagtttcccgccgacccaatggcgcaagcttgatgcc
tctgcctggagcgaagttttcgaccttaagctcggttgggatgtcaccgcatttggcggc
aacaatttcgccgcgcaagggttaacgctgttcaccctgcgtaatggctcgccgaaaggt
atgccttacgagaaatgctacgccgagaaaatcatgcatgttcgcgaggcgcaggtcacg
ccgatgcattttcactggcgcaaacgcgaagacattatcaatcgtggcggcggtaattta
attgtggaactgtggaatgcggggctccgggagcaaacagaggacagcgacgtgaacgtg
gtgattgacggctgtcggcaaacccatgccgcgggcagccaactacgcctgacgccgggg
gagagcatctgcctgccgccgggcctgtatcacagcttctgggcggaaaaaggttttggc
gacgtgctggttggcgaggtctcatctgttaatgacgacgaccacgataaccattttctg
caccctatcacccgttataacgacattgaagaagatgaaccggcgcagctggtgctgtgt
aacgagtatcgcctgttccgctaa

DBGET integrated database retrieval system