KEGG   Citrobacter freundii: CFNIH1_08460Help
Entry
CFNIH1_08460      CDS       T03077                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cfd  Citrobacter freundii
Pathway
cfd00564  Glycerophospholipid metabolism
cfd01100  Metabolic pathways
cfd01110  Biosynthesis of secondary metabolites
Module
cfd_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CFNIH1_08460 (psd)
Enzymes [BR:cfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CFNIH1_08460 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AHY11536
Position
complement(1749009..1749977)
Genome map
AA seq 322 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTASY
RTFNDFFVRPLRDEARPVNTDPNVLVMPADGVINQLGNIEEDKLLQAKGHSYTLEALLAG
NYQMADKFRNGTFVTTYLSPRDYHRVHMPCNGILREMMYVPGDLFSVNILTAQNVPNLFA
RNERVICLFDTEFGPMVQILVGATIVGSIETVWAGTITPPREGVIKRWTWPEGESEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVNLVEQLQDLSVTKIGQPMAISTETFVTPEAEPAPL
PKEEIEAEHDASPLVDDKKDET
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaactcatttaagctttcgctacaatacattctgccgaaactatggctcactcgc
ctggcgggctggggtgcgagcaaacgagcgggatggctgaccaaactggtgatcgatctg
ttcgtgaaatattacaaggtcgatatgaaagaggcgcaaaagccggataccgccagctat
cgcacctttaacgacttctttgttcgtcccctgcgcgacgaggctcgtccagtcaatacc
gatccgaatgtactggtcatgcctgccgacggcgtgatcaaccagttaggtaacatcgaa
gaagacaagctgttacaggccaaagggcacagctatacgcttgaagcgctgctggccggc
aactaccagatggcggacaaattccgcaacggtacgtttgtgaccacttacttatcacca
cgcgattaccaccgggtacatatgccatgtaacggtatcctgcgcgaaatgatgtacgtg
ccaggcgacctcttctctgtaaacatcctgacagcgcaaaacgtacctaatctgtttgcc
cgtaacgaacgcgttatttgcctgtttgataccgagtttggcccaatggtgcaaattctg
gtcggggcgactatcgttggcagcattgaaaccgtatgggctggcaccattaccccaccg
cgcgaaggcgtaattaaacgctggacctggcctgaaggcgaaagcgaagggtcagtggca
ctgctgaaaggtcaggaaatgggccgctttaagctcggttccaccgtcatcaacctgttc
gcaccgggcaaagttaacctggttgagcaattgcaggacctttcagtcacgaaaatcggt
cagccaatggccatctcaaccgagactttcgtgacgccagaggcagaacctgccccgctg
ccgaaagaagagatcgaagcagaacacgacgccagcccgctggttgacgacaaaaaagac
gaaacttaa

DBGET integrated database retrieval system