KEGG   Citrobacter freundii: CFNIH1_21405Help
Entry
CFNIH1_21405      CDS       T03077                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cfd  Citrobacter freundii
Pathway
cfd00030  Pentose phosphate pathway
cfd00480  Glutathione metabolism
cfd01100  Metabolic pathways
cfd01110  Biosynthesis of secondary metabolites
cfd01120  Microbial metabolism in diverse environments
cfd01130  Biosynthesis of antibiotics
cfd01200  Carbon metabolism
Module
cfd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cfd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFNIH1_21405
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CFNIH1_21405
Enzymes [BR:cfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CFNIH1_21405
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CFNIH1_21405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA Shikimate_DH F420_oxidored 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Motif
Other DBs
NCBI-ProteinID: AHY13989
Position
complement(4374700..4376106)
Genome map
AA seq 468 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVVAENPGKKLVPYYTVKEF
VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLSNEELATTFTEWNEGELSSYLIDITKDIFT
KKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAAS
KVLSGPQAKLAGDKAEFVEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAENKGIANLLLAPYFKNIADEYQQALRDVVAYAVQNGIPVPT
FSAAVAYYDSYRSAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcaacagatcggcgttgtcggtatggcagtgatggggcgcaacctggcgctc
aacatcgaaagccgcggttataccgtctccatcttcaaccgctcccgcgaaaaaactgaa
gaagttgttgccgagaacccgggtaagaaactggttccttattacacggtgaaagagttc
gtcgagtctcttgaaaccccacgtcgtatcctgttaatggtgaaagcgggcgcaggcaca
gatgctgccatcgactccctgaagccgtatctggataaaggcgacatcatcattgatggt
ggtaacaccttcttccaggacactattcgtcgtaaccgtgaactgtccgcagaaggcttt
aacttcatcggtaccggcgtatccggcggtgaagagggcgcactgaaaggcccgtccatc
atgcctggtggacagaaagaagcctacgaactggttgcgccgatcctgaccaaaattgct
gctgtggcggaagatggtgagccgtgcgtgacctacatcggcgctgacggcgcgggtcat
tacgtgaagatggttcacaacggtatcgaatacggcgacatgcagctgattgctgaagcc
tattctctgctgaaaggtggcctgaacctgtctaatgaagaactggcaaccaccttcacc
gagtggaatgaaggtgagctgagcagctacctgatcgacattaccaaagacatcttcacc
aaaaaagatgaagagggtaaatacctggttgacgtgatcctggacgaagcagcgaacaaa
ggcaccggtaaatggaccagccagagctctctggatctgggcgaacccctgtcgctgatc
accgagtccgtattcgcgcgttacatctcttctctgaaagatcagcgcgtggcggcatct
aaggtgctgtccggcccgcaggctaaactggctggcgataaagccgagttcgttgagaaa
gtgcgtcgcgcgctgtatctgggcaaaatcgtctcctacgcgcagggcttctctcagttg
cgtgctgcgtctgacgagtacaactgggatctgaactacggcgagatcgcgaagattttc
cgcgcgggctgcattattcgtgcgcagttcctgcagaaaatcacggacgcgtatgctgaa
aacaaaggcatcgccaacctgctgctggcaccgtatttcaaaaatattgccgacgaatac
cagcaggcgctgcgtgacgtcgtggcctacgctgtgcagaacggtattccggtaccgact
ttctccgctgctgtagcctactacgacagctaccgttctgcggtactgccggcaaacctg
atccaggcccagcgtgattacttcggtgcgcacacttataaacgcatcgataaagaaggc
gtgttccacaccgaatggctggattaa

DBGET integrated database retrieval system